KEGG   Brucella canis ATCC 23365: BCAN_A0310Help
Entry
BCAN_A0310        CDS       T00623                                 

Gene name
apaG
Definition
(GenBank) Protein apaG
  KO
K06195  ApaG protein
Organism
bcs  Brucella canis ATCC 23365
Brite
KEGG Orthology (KO) [BR:bcs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BCAN_A0310 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 PUMA
Motif
Other DBs
NCBI-ProteinID: ABX61401
UniProt: A9M7Z1
Position
I:complement(316022..316414)
Genome map
AA seq 130 aa AA seqDB search
MYSAVTRGIEVTVEPFYLEVQSEPEENRYVWGYRVTIVNNSSETVQLCSRYWQITDANGH
VQEVRGSGVVGEQPVLDPGDSYQYSSGCPLTTSSGVMVGRYQMKGEDGAQFEIEIPAFSL
DVPEQRRTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatagtgcggtaacacgcgggatcgaagttacggtcgagcccttttatctggaagtc
caatccgagccggaagaaaaccgttatgtatggggttatcgcgtcacgatcgtgaacaac
tcatccgaaacggtgcagctttgctcgcgctactggcagatcaccgacgccaacggccat
gtgcaagaagtgcgcggttcaggcgtggtcggcgagcagcctgttctcgatccgggcgat
tcataccagtattcttccggttgcccgctcacaacctcgtcaggcgtgatggtcgggcgc
taccagatgaagggcgaagacggcgcacaattcgagatcgagattcccgccttttcactc
gacgtacccgaacagcgccgcacgctgaactga

DBGET integrated database retrieval system