KEGG   Brucella canis ATCC 23365: BCAN_A1038
Entry
BCAN_A1038        CDS       T00623                                 

Name
(GenBank) Hypothetical protein
Organism
bcs  Brucella canis ATCC 23365
SSDB
Motif
Pfam: Apolipoprotein ApoLp-III Baculo_PEP_C DUF2443 Prominin
Other DBs
NCBI-ProteinID: ABX62091
UniProt: A9MB38
Position
I:complement(987127..991800)
AA seq 1557 aa
MASKSKAQKLDLEVEKALEQALDIDFGDDIDIDMDLGAFDEGFSIDDLEEQISRAAEELV
AEQQAKAAEPVGNEPVVKAASVITTASVIATPAAPPVPPVVKAASSAPAIAANTEHKPAN
VVAEPVSAQETAAKPAAAVATATPVATPVRTPANDDSRSDKAIAAAPRRITEHSSKLYWT
TTAISVLWAAGGVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVALPIAMFWGFAQLV
KRAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELE
TLVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSA
SNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFA
NLLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSD
RGRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMV
DDIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD
TLAARTGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL
EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQS
ALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHVLDGH
EQTIETRAAEIRSTLTDSTASLSQILQDHGEILEQRTTSLQNAIANSSAAISSAFEGQTG
IIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAANTLAAEAAKAGEALDGF
GESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTSETLA
SHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDTTAVT
LEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRLRSEN
AALVNALASRTAETIAAVQQAKVGLSDNVSELIDRLAASNGELGKLIDAATRNLADIDGR
LVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIADRFDEHGKVLSS
ASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVASAFQRAEGQTR
VSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELDTTRGELKRGVLDMPAEAKET
TTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGRADRPVSRPAASRPAPVQAPVRAPIA
PLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLARASREEEEAAQPKVQPAATPR
SPSHVVESLNSLSVDIARAIDHEASVELWDRYRRGERNVFTRRLYTLKGQQTFDDIKRKY
QTDGEFRRAVDRYMDDFQRLLEDVARNDRDNMVTQTYLTSDTGKVYTMLAHASGRLR
NT seq 4674 nt   +upstreamnt  +downstreamnt
atggcttcaaaatccaaggcacagaagctcgaccttgaggttgaaaaggcgctggaacag
gcactggatatcgatttcggagacgatattgatatcgatatggacttgggtgcgtttgac
gaaggcttctcgattgacgatctggaagagcagatttcccgtgccgcggaagaactcgtc
gccgaacagcaggcgaaagccgccgagcctgttggaaacgagccggtcgtcaaggccgct
tcggtcatcacaacggcttccgtgattgcaacgcctgctgcgcctccggtgccgcctgtc
gtcaaggcggcctcctctgctcccgctatagctgccaataccgagcacaaacctgccaat
gtagttgccgaacccgtttcagcacaggagaccgcggccaagcctgccgctgcggtcgcc
actgcaacgccggtcgccacgcctgttcgtacaccagcaaatgacgattcgcgcagcgac
aaggccatcgccgccgcgccgcgccgcatcaccgagcattcctctaagctttactggacc
acgaccgcaatcagcgtgctgtgggcggctggcggcgttgctatcagcaaggcgatcaat
ccggaagtcttctccagcctgcaagccaccaaagatttcttcaccgcacccgccggactt
ggtgtggttgccggtgtggcgttgccgatcgcgatgttctggggcttcgcacaactcgtc
aagcgtgctcaggaaatgcagaacgctgcgcgcagcatgaccgatgccgcgctcaaactg
cttcagccggaagctgtcgcgggtgatcgcgtctccacgctgggccaggccgtgcgccgc
gaagttgcagccatgaacgaaggcatcgaacgcacacttgcgcgcgcggtggagctggaa
acgctcgtccaatccgaggtcaaccagcttgagcgcgcctatagcgacaatgaggtgcgt
atccgctcgctcgtcagcgatcttggcaatgagcgtgaagcagttgtcagccatgccgag
cgtgttcgttcgtccatctctggtgcgcatgaacagcttagggaagaattatcaagtgca
tccaatatcatacgcgacaatgttctgtccgcgtctcagcagctcagcgcgctcttgggc
gattctggcgagcgcctcatcagcaatatcaacgaaagcggcggcgctattgccgatgca
atcgagaagcgcaccggcgatattggaaatcgcatcaccacctccggcgaagcttttgcc
aatctgctcgatacccgcatcgcaacgcttgacgaacagtcgcgcacgatctccgggaag
ttgacgcaggctctggacgagcgcaccaccggcattgcaaatgtgcttggcagcgcgacc
cagaccatggtgagcgagttcgacacgcgccttgccaatctggaaaacaccctttccgac
cgtggccgctcgttgctggcagagtttgaggcgcgcgcccatgcgcttgacaacagcacc
gaaaagctgaatgcggcgctggaaacccgttcgcgccagatcaacgaaaacctcattgcc
cgcacccgtgaaatcgccgaaaccttctcgggcggccgcaattcgctgggcgcgatggtg
gacgacatcaaggtgaagatcggcgacgatctgacctcgatcagcgaaagcgtcggcaat
gttctgatcgataaggcagcagccttcgagggcaagctggccgaaagccgcgatcttctg
gcggcaacgctggaaggcgaaacagagcgcgtttcctcggtcattcgcggccatgcggat
acgcttgccgcgcgcaccggcgatatccagaacgctatcgatgcaagcgcctcagcgctc
aatgaagtcacagacaagcacgcggcaatcttggccgagcgcaccagtgcgctgcagcag
gccatgtccagcaatgtttccctgctggatgcgagcttcgcagaccatgcccgttcactt
gaagagcgcactgcgtccctgcacaatgtcattgcaggaaatcaggcaatgctggctcag
ctcatggatgagcgtgcggctgcaatgcgcgagaatttcaacgaaaatcgtgaagtgctg
gcccgcaccttcgatgaacgtattggcagccttcagtcgcttatcgcggaaaaccagagc
gcccttgagcgtattctggatgagcgcgcgcgcaatatggcggaatccctcggcgctggc
cgcgatgcctttgaaacggcactgggcgagcatgtccgcacggtcgaggaacgcacaagc
ggcttgcaagccgttctgaacaaccacaatgatgcgctggcgcatgttctggatggacat
gagcagaccattgaaacgcgggccgctgaaatccgctccaccctgacggacagcacggct
tcgctcagccagatcttgcaggatcatggcgagattctggagcagcgcaccacgagcctg
caaaacgccatcgccaacagcagcgccgccatcagcagcgcctttgagggccagaccggc
attatcgaagaacgcaccgagaccatggaaaaggctctttccatcggcgtggacaatgtg
cgccgcgcactggaacaaagtgcaggcgtggtcgccggaaagctgcgtgaaaagatcggt
gaagctgccaacacacttgccgctgaggccgccaaagccggcgaagccctcgacggcttt
ggcgaaagcttcagtgctcggctcatcgataatctttccggcaccgaagcccgcctcggc
gaacgcgcggatgctattgccggacgccttggcgacattgaaagccgccttaccgacgag
cttgggaccattgaggcacgcattgccgatacggccgccaaaacaagcgaaacgcttgcc
agccacagcgaatccttctcggccagcgttgccgacaatctcgctggcacagaaacacgt
cttgtcgagcgtgcggatgcgatcgcaacccgtcttggcgatatcggctcgcgcatcacg
atggagctcggctccgtcgaggctcgcattgcgcaggtgacggatacgacggcggttacg
ctggaagaacgcacccgtgagctcaatgccgtcctcgccgctcgctcgcaggaaatcacc
aaaatcctcaacgatacggccgaaccgctggttcagcgccttgccgatagtggccgtggc
cttgcccagcagcttgaagaagcaacccatgcagcaactgatcgcctgcgttcggaaaat
gcggcgctcgtcaatgcgctggcaagccgcacggcggaaaccatcgctgcggtccagcag
gcaaaggtcgggctttccgacaatgtcagcgaactcattgaccgcctcgccgcttccaat
ggtgagcttggcaagctgattgatgccgccacgcgcaaccttgccgatatcgatgggcgt
ctggtagactctacgacgagctttgtggaaaacacgaaccgcgcggcgcagatgttccag
gcttcaactggcctcatcgacagcaatctcggtacgcttcgtacgctatccgacaatacc
ttgtcgcaaatcgccgatattgccgaccgcttcgatgaacatggcaaggttctgtcttcg
gcatccgatatgatcaattccgcacagaacggcctcgtcagcacacttgaggagcgtcat
caggcgctcgacaagctggcttccggtctggtggaaaaatcggaaggcgtcgaaaagctc
atgcaatccttcgaggctctggttgcctcggccttccagcgcgccgaaggccagacccgc
gtttcggcggaaaagatgcgcgagagcgtttcggatatcgtcgaacaggccgcacagaag
ttctcggcagcgaccgacgaaattcgccgcacggcaagcgaaatccgcgccgaactcgat
acaacgcgcggcgaactgaagcgtggcgttctcgacatgcctgccgaagcgaaggaaacg
acgaccgccatgcgcaaggccgtgagcgagcagatcaacgcgctcaaggaacttgctgaa
attgtcaacaagtcgggccgtctggttgatgtgggtgaaggccgtgccgaccgccctgtg
tcgcgccccgcagcatctcgccctgctccggttcaagctcctgttcgggcaccgatcgcg
cctctggcacagacagatgttgcagtccggtcgcgtccggtggaagcgccgaaccaaaag
cctgctccagcggcatctgcggaaaagccgcgcggttgggtttccgatcttcttgcccgc
gcctcacgtgaggaagaagaagccgcgcagcccaaggtgcagccggccgcaacgccgcgt
tctccgagccatgtggttgaatcgctcaactcgctttccgtcgatatcgcccgtgctatc
gaccacgaagcttcggttgagctttgggaccgttatcgccgcggtgagcgcaatgttttc
acccgccgtctctatacgctgaaaggtcagcagacctttgacgatatcaagcgcaagtat
cagaccgatggtgaattccgccgcgccgtagatcgttacatggacgatttccaacgtctt
ctcgaagacgttgcccgcaatgaccgcgataatatggtgacgcagacttacctgacatcc
gacacaggcaaggtttacaccatgctcgcccatgcaagcggacgccttcggtag

DBGET integrated database retrieval system