KEGG   Brucella canis ATCC 23365: BCAN_A1051
Entry
BCAN_A1051        CDS       T00623                                 

Name
(GenBank) Basic proline-rich protein precursor
Organism
bcs  Brucella canis ATCC 23365
SSDB
Motif
Pfam: FliO
Other DBs
NCBI-ProteinID: ABX62104
UniProt: A9MB51
Position
I:complement(1000936..1002168)
AA seq 410 aa
MKEWLSGIIGESAANIVGFVLIFAIILGGIFVVLGIIRRFSGGTFVSSGRMRQPRLSVMD
AAAVDSRRKLVLIRRDDVEHLLLIGGPTDVVVEQNIVLESRAGTHAPGTHALGTHAQSSR
IEPEHIERFRQHEVLANEKTERPALSVQSQPGDEREETIQLSSAIAAPVYRKPEPPKAEN
VRPAPSEPAPMRAPQPPVTPPPAAPRPEAPASQVSEPHPRPASNYPSQPRTVLPPRPAPS
AAPNSVRAHPAYPLSQVSRGVVSSTSNIQAATVATAATANLGSIVPERESAAPAKPAAPA
PNQPERSERPERPERPQQRIEPVVPFVAQEVRQPESADDDLDNLGGTLHDAIMADLGSNA
GKDENMEELARLRWKTNYSARLIFHLPMNSRKMPRPKKPSKTKWKSCLAS
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgaaggaatggctcagcggcatcatcggtgaaagcgcggctaatattgtcggctttgtg
cttatatttgcaatcatccttggcggaatttttgttgttctcggcatcattcgccgtttc
agcggcggcacatttgtatccagcgggcgcatgcgccagccccgcctttcggtgatggat
gccgccgcggtagacagccggcgcaagctggttctgatccgccgcgacgatgtggaacat
ctgctcctgatcggtggcccgaccgatgtggttgtcgaacagaatatcgttctggaatcg
cgcgctggcacccatgcccctggaactcatgcccttggtacccacgcacagagctcgcgt
atcgaaccggaacatattgaacgcttccgccagcacgaagtgcttgccaatgagaagacg
gaacggcctgccctttccgtccagtcccagcccggagacgaacgcgaggaaactattcag
ctaagctcggccatcgcggcgcccgtctatcgcaagccggagccgccgaaggctgagaac
gtccggcccgcgccctccgaacccgcaccaatgcgggcaccgcagcctcccgtgacgcca
ccgccagccgcgccgcgccctgaagcgcctgcgtcgcaggtttccgagccgcatccgcgc
ccagcttcaaattacccgtcacagccgcgcacggttcttcccccgcgccccgcgccatcg
gctgccccaaacagcgttcgcgcgcatccagcctatccgctgagccaggtttcgcgcggc
gtggtaagttccacatcaaatatccaggcagccacggttgcaacggccgcgacagcaaat
ctgggcagcattgtgcccgaacgcgaatctgccgctccggcaaaacccgcagcgcccgcg
ccgaatcagccggaacgttcagagcgtccagaacgcccggaacgcccacaacaacgcatc
gagccggttgttccctttgtcgcccaggaagtcaggcagcccgaaagcgcagatgacgat
ctggataaccttggcggcacattgcatgatgccattatggccgatcttggcagcaatgcc
ggtaaagatgaaaatatggaggagttggcacggcttcgctggaagacgaactactcagct
cgcttgatatttcacctaccgatgaacagccggaagatgccaaggccgaagaaaccatcg
aagacgaaatggaaaagctgcttggcgagttga

DBGET integrated database retrieval system