KEGG   Brucella canis ATCC 23365: BCAN_A1279
Entry
BCAN_A1279        CDS       T00623                                 

Name
(GenBank) Rhomboid family protein
Organism
bcs  Brucella canis ATCC 23365
SSDB
Motif
Pfam: Rhomboid
Other DBs
NCBI-ProteinID: ABX62325
UniProt: A9M5S0
Position
I:complement(1220977..1221738)
AA seq 253 aa
MLPKDKREQHFMSIPQPEMRGTGGREPIFNIPGVVIALIGLCVAVYVYQNYILSERQDFE
FMMNFALIPARFSMASGFVDPAVIFTFISYSFMHGSFAHIAVNMIWLAAFGSPLAGRIGA
VRMILFWVFTSVVAGLTHYALHPESLSPLVGASGAISGMMGAAARYGFRRVGYGRRSEFA
GPVLPIGLTLTLKPVLIFVGVWFLINIVTGLYSTGGADFSRIAWEAHIGGFIAGFFGIPL
MDRPRSYDAVLRR
NT seq 762 nt   +upstreamnt  +downstreamnt
atgcttccgaaagacaagagagagcagcacttcatgagcattccccagccggaaatgcgc
ggcacaggcggccgcgagccgatcttcaatattccgggtgtcgtgattgctctgatcggg
ttgtgtgtcgcggtctatgtctatcagaattatattctgagcgagcggcaggattttgag
ttcatgatgaactttgcgctgatcccggcgcgcttttcgatggcgagcggctttgttgat
ccggcggtgatttttacgtttatcagctattccttcatgcatggcagttttgcgcatatt
gccgtcaatatgatctggcttgccgcattcggctcgccgctggccgggcgaatcggcgcg
gtccggatgatcctattctgggttttcacgtcggtcgtcgcggggcttacgcattacgca
ctccatcccgaaagcctttcgccgctggtgggtgcgtcgggcgcgatttcgggcatgatg
ggagctgccgcccgctatggttttcggcgtgtcggctatggccggcgctcggaatttgcc
gggccggtgcttcccatcgggctgacgctgacgctcaagcccgtcctcatttttgtcggc
gtctggtttctcatcaatatcgtcaccggcctttattccactggcggcgccgacttttcc
cgcattgcctgggaggcgcatataggcggcttcattgccgggtttttcgggattccactg
atggaccgcccgcgcagctatgatgccgttttgaggcgatag

DBGET integrated database retrieval system