KEGG   Brucella canis ATCC 23365: BCAN_A1282
Entry
BCAN_A1282        CDS       T00623                                 

Name
(GenBank) Hypothetical protein
Organism
bcs  Brucella canis ATCC 23365
SSDB
Motif
Pfam: Hexapep Hexapep_2 Fucokinase
Other DBs
NCBI-ProteinID: ABX62328
UniProt: A9M5S3
Position
I:complement(1223666..1224193)
AA seq 175 aa
MPIYAYNGHKPQFADRESNWIAPDATLIGKVVVGENAGFWFGAVLRGDNEPITIGADTNV
QEQTIMHTDIGFPLTIGAGCTIGHRAILHGCTIGENTLIGMGAIVLNGAKVGKNCLIGAG
TLVKEGMEIPDNSLVVGSPARVLRQLDDAAVEKLRASAKHYVERGHSFMRGMEPA
NT seq 528 nt   +upstreamnt  +downstreamnt
atgccgatctatgcatataacgggcacaagccgcagtttgcggaccgcgagagcaactgg
attgcaccggatgcgacgctgatcggcaaggtggtcgtgggcgagaatgcgggtttctgg
ttcggcgcggtgttgcgcggcgataatgagccaatcactatcggtgccgataccaatgtg
caggaacagacgatcatgcacaccgatatcggctttccgctgaccatcggtgcgggctgc
actatcgggcaccgtgcgattctccatggctgcacgattggcgagaatactcttatcggc
atgggcgcgattgtgctcaatggcgcgaaggtcggcaagaattgccttatcggggcggga
acattggtgaaagaagggatggaaatccctgataattcgcttgttgtcggctctcccgcg
cgtgtcctgcgccagcttgacgatgctgccgttgaaaagctgcgggcctctgcaaagcat
tatgtggagaggggacattccttcatgcgcggcatggagcctgcctga

DBGET integrated database retrieval system