KEGG   Brucella canis ATCC 23365: BCAN_A1495Help
Entry
BCAN_A1495        CDS       T00623                                 

Definition
(GenBank) protein of unknown function DUF1498
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
bcs  Brucella canis ATCC 23365
Pathway
bcs00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCAN_A1495
Enzymes [BR:bcs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     BCAN_A1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2
Motif
Other DBs
NCBI-ProteinID: ABX62522
UniProt: A9M6C6
Position
I:complement(1416713..1417399)
Genome map
AA seq 228 aa AA seqDB search
MKRSEINEIIRESDAFIRSFGYIMPPFAYWSPEELKQRTAGDVAAIRKARLGWDITDYGQ
GKFADLGLFLFTVRNGNAEDLKRGTGMLYAEKIMISRKNQLSPMHRHVVKAEDIINRGGG
TLVLELFNSRPDGSVDEETDVTVATDGRLVTQKAGAHLKLQPGESVTLLPGNWHAFWGEG
GDVLIGEVSTVNNDLTDNIFREPIGRFSDIEENEQPLHLLVSDYDKWL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctctgaaatcaatgaaatcatccgtgaaagcgatgcctttatccgctcgttc
ggttatatcatgccgccctttgcctattggtcgccggaagagctgaagcagcgcacggct
ggcgatgtggcggcgatccgcaaggcgcggcttggctgggatattaccgattacgggcag
ggcaagtttgccgatctcggcctgtttcttttcacggttcgcaatggcaatgccgaggac
ctgaagcgtggtacaggcatgctctatgccgaaaagatcatgatttcgcgtaaaaatcag
ctttcccccatgcatcgccatgtggtgaaggcggaagatatcatcaatcgcggtggcggg
acgctggtgctggaattgttcaattcgcggcctgatggcagcgtggacgaggaaaccgac
gtgactgtggcgaccgatgggcggcttgttacccagaaggcgggcgcgcatctgaagctc
cagcccggcgagagcgtaacgctcctgcccggcaattggcacgctttctggggtgagggc
ggcgatgtgctgatcggtgaggtttcgactgtcaataacgatctgaccgacaatatcttc
cgcgagccgattggccgcttctcggatatcgaggaaaacgagcagcccttgcatctgctt
gtgtctgattacgacaagtggctatag

DBGET integrated database retrieval system