KEGG   Brucella canis ATCC 23365: BCAN_A1671
Entry
BCAN_A1671        CDS       T00623                                 

Name
(GenBank) Hypothetical protein
Organism
bcs  Brucella canis ATCC 23365
SSDB
Motif
Pfam: PepSY_2
Other DBs
NCBI-ProteinID: ABX62688
UniProt: A9M741
Position
I:1580624..1580941
AA seq 105 aa
MKIIITAAALVALSATGVMAQKTQCDAKPLDEKSIDALVQLSNEFTWKISEMEIDDGCYE
LHVTDENGNVLKVKVDPETMKVVAGKVKRYGDGTPAKDKGHAPKN
NT seq 318 nt   +upstreamnt  +downstreamnt
atgaaaatcatcatcacggcagcagccctggttgcactgtccgccacgggcgtaatggcc
caaaaaacccaatgcgatgcaaagccgctggatgagaagtccatcgatgccttggtacag
ttgtcgaacgaatttacgtggaaaatttccgaaatggagattgacgacggctgttatgag
ctgcacgttaccgatgaaaacggcaatgtcctcaaggtcaaggtggaccctgaaacgatg
aaggtggttgctggcaaagtaaagcggtacggcgatggcactccggccaaggacaagggc
cacgcgcccaagaactag

DBGET integrated database retrieval system