KEGG   Brucella canis ATCC 23365: BCAN_A2050
Entry
BCAN_A2050        CDS       T00623                                 

Name
(GenBank) cAMP-dependent protein kinase regulatory subunit
Organism
bcs  Brucella canis ATCC 23365
SSDB
Motif
Pfam: cNMP_binding
Other DBs
NCBI-ProteinID: ABX63038
UniProt: A9M991
Position
I:complement(1925974..1926435)
AA seq 153 aa
MALDDDIRILGTVGLFESFTPEQLRLLAFGAERLVLRAGRELFREGQSADCAYIIVTGTI
TLFHEGDEGRVTIRPVGPGAILGEMALIAQTTRLTGAVADVETEVIRISRSIFRRILEEY
PEVAAALHAHISRNLIELIGQIEQVAPRLANRD
NT seq 462 nt   +upstreamnt  +downstreamnt
atggcgctagacgacgatattcgcattctcggcacggtgggcctgttcgagtctttcacg
cccgaacagttgcgcctgcttgccttcggtgcggagcggcttgtcctgcgtgcgggacgc
gagcttttccgcgagggccagagtgccgattgcgcctatatcatcgttaccggcacgatt
accctgtttcatgaaggtgatgaagggcgggtcacgatccgccctgtcggccccggcgcg
atattgggggaaatggcgctcatcgcccagaccactcgtctcaccggcgcggtggcggat
gtggaaaccgaagtcatccgcatcagccgctccatcttccggcgcattctggaagaatac
ccggaagtggccgccgcgcttcatgcgcatatcagccgcaatcttatcgagcttatcggc
cagatcgagcaggtcgcgccgcggcttgcaaaccgcgactga

DBGET integrated database retrieval system