KEGG   Brucella canis ATCC 23365: BCAN_A2118Help
Entry
BCAN_A2118        CDS       T00623                                 

Gene name
secB
Definition
(GenBank) protein-export protein SecB
  KO
K03071  preprotein translocase subunit SecB
Organism
bcs  Brucella canis ATCC 23365
Pathway
bcs02024  Quorum sensing
bcs03060  Protein export
bcs03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bcs00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BCAN_A2118 (secB)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BCAN_A2118 (secB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BCAN_A2118 (secB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bcs03110]
    BCAN_A2118 (secB)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcs02044]
    BCAN_A2118 (secB)
Chaperones and folding catalysts [BR:bcs03110]
 Other chaperones and cochaperones
  SecB
   BCAN_A2118 (secB)
Secretion system [BR:bcs02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BCAN_A2118 (secB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecB
Motif
Other DBs
NCBI-ProteinID: ABX63102
UniProt: A9M9Q7
Position
I:complement(1996178..1996669)
Genome map
AA seq 163 aa AA seqDB search
MSDKAAGETKNGNGATTEPSLNILAQYVKDLSFESPGAPLSLRPREKAPSININVNVNAN
PLSETDFDVVLTLEAKAVDGKDILFNTELVYGGVFRIQGIPQEHMLPLLFIECPRLLFPF
ARQIIADATRNGGYPPLMIDPIDFAQMFQQRMAEEQAESAVKS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataaggccgcgggcgaaacgaagaatggcaatggcgcaaccaccgagccgtcc
ctcaacattctggcacaatatgtgaaggatctttcctttgaaagcccaggcgcgccgctg
tcgctgcgcccgcgtgaaaaagcgccttccatcaacatcaacgtcaatgtgaacgccaat
ccgctttccgaaacggatttcgacgttgtcctgacgctggaagccaaggctgttgacggc
aaggatatccttttcaacacggaactggtctatggcggcgtgttccgcatccagggcatt
ccgcaggaacatatgcttccgctcctgttcatcgaatgcccgcgcctattgttcccgttc
gcgcgccagatcattgccgacgcaacgcgcaatggcggctacccgccgctgatgatcgac
ccgatcgatttcgcgcagatgttccagcaacgcatggccgaagaacaggccgagtccgct
gtgaagagctga

DBGET integrated database retrieval system