KEGG   Brucella canis ATCC 23365: BCAN_B0035Help
Entry
BCAN_B0035        CDS       T00623                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcs  Brucella canis ATCC 23365
Pathway
bcs00010  Glycolysis / Gluconeogenesis
bcs00020  Citrate cycle (TCA cycle)
bcs00620  Pyruvate metabolism
bcs01100  Metabolic pathways
bcs01110  Biosynthesis of secondary metabolites
bcs01120  Microbial metabolism in diverse environments
bcs01130  Biosynthesis of antibiotics
bcs01200  Carbon metabolism
Module
bcs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAN_B0035
   00020 Citrate cycle (TCA cycle)
    BCAN_B0035
   00620 Pyruvate metabolism
    BCAN_B0035
Enzymes [BR:bcs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BCAN_B0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: ABX63238
UniProt: A9MDF0
Position
II:30167..31432
Genome map
AA seq 421 aa AA seqDB search
MPVEVVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKATMELEAEVDGRIGQLL
VKDGARANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAETPVAASPVPAAPAVSAPA
SGEVRHKASPLARRLAAELGVSLDGLAGSGARGRIVRIDVERAAASKPVPVAAAAAPVAA
PAEASSKAIPVGIGEYEAVPHTSMRRTIARCLLEAKITVPHFYLNVDCEIDALLALRSQI
NEKREGSARISVNDFVIKASAAALRRVPDANVIWTDEALLKLKDVDIAVAVATEGGLITP
IIRSADQMSLGAISAQMKSLAARARENRLKPEEFQGGGFSISNLGMYGVKSFSAIINPPQ
SAILAVGAGERRPIERNGELAFATMMSVTLSVDHRAVDGALGAQLLAAFKAGIEDPMSLL
V
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgccggttgaagtcgtattgcctgccctttcggcaggaatggaagatgcagtcatcgcg
cgctggctcaaggccgaaggcgacgcggtgagcaagggcgacctgatcgccgaagtcgaa
accgacaaggcgacgatggagcttgaagccgaagtggatggccgcattggccagcttctg
gtgaaggacggtgcgcgcgccaatgtcaatcaggtgatcgccctgcttttgaaggaaggc
gaagatgcttctgcaatggccggatttgcggtcggctccagtcctgtggccgtggcagaa
gccgaaacccctgttgcagcctcgccggtgccagccgcaccagcagtaagcgcgcccgcc
tccggtgaagtgcgccacaaggcttcgccgctcgcccgccgcctggctgcggaactgggc
gtttcgctggacgggcttgcgggaagtggcgcaaggggccgtatcgtacggatcgacgtg
gaacgcgcggccgcctcgaagccggttccggttgccgccgctgccgctccagtcgccgca
cctgcggaagcttcgtcgaaagccattccggttggcatcggcgagtatgaagccgttccg
cacacatccatgcgccgcactattgcccgctgcttgctggaagccaagataacggtgccg
catttctatctgaacgtggattgcgagatcgatgcgcttctggcactgcgcagccagatc
aacgagaagcgggaaggttcggcccgtatttccgtcaatgattttgtcatcaaggcttcc
gccgccgccctgcgccgggtgcccgatgccaatgtcatatggacagacgaggcgcttttg
aagctgaaggacgtcgatattgccgttgcggtggcgacggaaggcggccttatcacaccg
attattcgcagtgccgaccagatgagccttggcgctatttcggcgcagatgaagtctctg
gccgcgcgtgcccgcgaaaaccgcctgaagccggaagaattccagggcggtggcttttcg
atttccaatctcggcatgtatggtgtcaaatccttttcggccatcatcaatccgccgcaa
agcgccattctggcggttggcgcgggcgaacgccgcccaatcgaacgcaatggtgagctt
gctttcgccaccatgatgagcgtgacgctttcggttgaccatcgcgcggtcgacggcgcc
ctgggtgcgcaactgctcgcggccttcaaggccggtattgaagatccgatgtctctgctt
gtctag

DBGET integrated database retrieval system