KEGG   Brucella canis ATCC 23365: BCAN_B0062
Entry
BCAN_B0062        CDS       T00623                                 

Name
(GenBank) P-type DNA transfer ATPase VirB11
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
bcs  Brucella canis ATCC 23365
Pathway
bcs03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bcs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BCAN_B0062
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcs02044]
    BCAN_B0062
Enzymes [BR:bcs01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     BCAN_B0062
Secretion system [BR:bcs02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BCAN_B0062
SSDB
Motif
Pfam: T2SSE AAA_7 NACHT ABC_tran AAA_22 TsaE Zeta_toxin AAA_16 RsgA_GTPase AAA_29 DUF87 AAA_18 AAA_23 TrwB_AAD_bind AAA_30 CEBP_ZZ cobW FtsK_SpoIIIE dNK AAA AAA_33 PduV-EutP RNA_helicase VirE DUF2075 Sigma54_activat Septin MobB MMR_HSR1 NB-ARC AAA_24 AAA_21 ATPase_2 Viral_helicase1 AAA_28 Roc Pox_A32 ATP_bind_1 PRK DEAD ResIII
Other DBs
NCBI-ProteinID: ABX63264
UniProt: A9MDH6
Position
II:complement(56803..57888)
AA seq 361 aa
MMSNRSDFIVPDEAAVKRAASVNFHLEPLRPWLDDPQITEVCVNRPGEVFCERASAWEYY
AVPNLDYEHLISLGTATARFVDQDISDSRPVLSAILPMGERIQIVRPPACEHGTISVTIR
KPSFTRRTLEDYAQQGFFKHVRPMSKSLTPFEQELLALKEAGDYMSFLRRAVQLERVIVV
AGETGSGKTTLMKALMQEIPFDQRLITIEDVPELFLPDHPNHVHLFYPSEAKEEENAPVT
AATLLRSCLRMKPTRILLAELRGGEAYDFINVAASGHGGSITSCHAGSCELTFERLALMV
LQNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHDGTGRHISEVWYDPNTKRALSLQHSEK
T
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgatgtcaaaccgaagtgactttattgtgcctgacgaggcggccgtcaaacgggcggcc
tcggtcaatttccatctggaaccgctgcgcccttggttggacgatccgcagatcaccgaa
gtttgcgtgaaccggccgggcgaagtgttctgcgagcgagcaagcgcgtgggaatactat
gcggtgccaaacctcgactatgaacacctgatttcgctgggaaccgccaccgcgcggttt
gtggatcaggatatttcggacagccgaccggtgctgtctgcgatcctgccgatgggtgag
cgcattcagattgtgcgcccgcccgcatgtgagcacggcaccatctcggtgacgatccgc
aagccgtctttcacccggcgcacactggaagactatgcgcagcagggctttttcaaacac
gtcagacccatgagtaagagcctgacgccgtttgaacaggaactgctcgcattgaaggaa
gctggtgattacatgagcttcctgcggcgggcggtacagcttgaaagggtgatcgtcgtc
gccggcgagacgggatcaggcaagaccacactgatgaaagcgctgatgcaggaaattccg
ttcgatcagcgcctgatcaccatcgaggacgtaccggagttgttcttgccggaccatccg
aaccacgtccacctgttttatccgagcgaagcgaaggaagaagaaaacgcaccagtgacg
gccgccacgctactgcggagctgcctgcgcatgaaaccgacgcgcatcctgcttgccgag
ctgcgcggcggcgaggcttacgatttcatcaacgtggccgcgtccggccatggcggcagc
atcaccagttgccatgccggttcgtgcgaactgactttcgagcggctggcattgatggtg
ttgcagaaccgccagggccgccagttgccatacgagatcatccgccggctgctctatctg
gtggtggatgtcgtcgtgcacgtccacaatggcgtgcacgacggcactggccgccatata
tctgaagtttggtacgacccgaatacaaaacgggcactgtcactgcaacacagtgagaag
acgtaa

DBGET integrated database retrieval system