KEGG   Brucella canis ATCC 23365: BCAN_B0065
Entry
BCAN_B0065        CDS       T00623                                 

Name
(GenBank) Type IV secretion system protein virB8
  KO
K03203  type IV secretion system protein VirB8
Organism
bcs  Brucella canis ATCC 23365
Pathway
bcs03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bcs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BCAN_B0065
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcs02044]
    BCAN_B0065
Secretion system [BR:bcs02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BCAN_B0065
SSDB
Motif
Pfam: VirB8
Other DBs
NCBI-ProteinID: ABX63267
UniProt: A9MDH9
Position
II:complement(59907..60626)
AA seq 239 aa
MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLVEKSERRAWKIAGAFGTITVLLGI
GIAGMLPLKQHVPYLVRVNAQTGAPDILTSLDEKSVSYDTVMDKYWLSQYVIARETYDWY
TLQKDYETVGMLSSPSEGQSYASQFQGDKALDKQYGSNVRTSVTIVSIVPNGKGIGTVRF
AKTTKRTNETGDGETTHWIATIGYQYVNPSLMSESARLTNPLGFNVTSYRVDPEMGVVQ
NT seq 720 nt   +upstreamnt  +downstreamnt
atgtttggacgcaaacaatctccacagaaatcagtaaagaacgggcagggcaatgcgcct
tcggtatatgacgaagcgttgaactgggaggccgcgcacgtccggctggtcgaaaaatcc
gaacgccgcgcgtggaaaatcgccggggctttcggcaccattaccgtgctgctcgggatc
ggcatcgccgggatgttaccgctaaagcaacatgtgccctacctggtgcgcgtcaacgca
cagacaggtgcgcctgatatcctgacctcgctcgacgagaagagtgtcagctacgacact
gtaatggataaatactggctctcgcagtacgtgatagcgcgtgaaacctacgactggtac
acgctgcaaaaggactacgaaaccgtaggcatgttgtcgtcgccgtccgaagggcagagc
tatgcaagccagttccagggcgataaggcgcttgacaagcaatatggctcaaatgtgcgc
acatcggtaacgatcgtaagcatcgtgccgaacggcaagggcatcggcacggtgcgcttt
gcgaagacgacaaagcgcaccaacgagaccggtgacggcgaaacaacgcactggatcgcc
accattggctaccaatacgtcaatccctctttgatgtcggaatcggcccgcctgacaaac
ccgctgggtttcaatgtcacgagctatcgcgttgatccagaaatgggagtggtgcaatga

DBGET integrated database retrieval system