KEGG   Brucella canis ATCC 23365: BCAN_B0066
Entry
BCAN_B0066        CDS       T00623                                 

Name
(GenBank) TraI protein
  KO
K03202  type IV secretion system protein VirB7
Organism
bcs  Brucella canis ATCC 23365
Pathway
bcs03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bcs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BCAN_B0066
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcs02044]
    BCAN_B0066
Secretion system [BR:bcs02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BCAN_B0066
SSDB
Motif
Pfam: LPAM_1
Other DBs
NCBI-ProteinID: ABX63268
UniProt: A9MDI0
Position
II:complement(60629..60802)
AA seq 57 aa
MKKVILAFVATAFLAGCTTTGPAVVPVLDGKPRVPVNKSVPAKPPLAQPNPVDTYED
NT seq 174 nt   +upstreamnt  +downstreamnt
atgaaaaaggtaatccttgcttttgtcgccacggccttccttgccggttgcactacaacg
gggccggccgtggtgccggttctcgatggcaaaccgcgggttcccgtcaacaaaagcgtt
ccggctaaaccgcccctggctcagcctaaccccgttgacacttacgaggactaa

DBGET integrated database retrieval system