KEGG   Brucella canis ATCC 23365: BCAN_B0069
Entry
BCAN_B0069        CDS       T00623                                 

Name
(GenBank) type IV secretion/conjugal transfer ATPase, VirB4 family
  KO
K03199  type IV secretion system protein VirB4 [EC:7.4.2.8]
Organism
bcs  Brucella canis ATCC 23365
Pathway
bcs03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bcs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BCAN_B0069
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcs02044]
    BCAN_B0069
Enzymes [BR:bcs01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     BCAN_B0069
Secretion system [BR:bcs02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BCAN_B0069
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_22 ABC_tran
Other DBs
NCBI-ProteinID: ABX63271
UniProt: A9MDI3
Position
II:complement(62914..65409)
AA seq 831 aa
MGAQSKYAQQLNNERSLAPFIPFRSQVGPTTVITRDGDFVRTWRIAGLAFETQDKEELLI
RKDQLNTLFRAIASNNVALWSHNVRRRTWDHLKSFFSNPFCDALDKKYYGSFSGYRMMSN
ELYLTVIYRPVPAKISRLFNVAVHRSHAEILQEQQLAIRKLDEIGNQIETSLRRYGGDDG
RGIEVLSTYEDKHGALCSQQLEFYNFLLSGEWQKVRVPSCPLDEYLGTGWVYAGTETIEI
RTANATRYARGIDFKDYASHTEPGILNGLMYSDYEYVITQSFSFMTKRDGKEFLTRQKQR
LQNTEDGSASQIMEMDIAIDQLGRGDFVMGEYHYSLLVFAEDMETVRHNTSHAMNILQDN
GFLATVIATATDAAFYAQLPCNWRYRPRVAGLTSLNFAGLSCFHNFRAGKRDGNPWGQAL
TLLKTPSGQPAYLNFHYSKGDEDNFDKKLLGNTRIIGQSGAGKTVLMNFCLAQAQKYLHN
APMGMCNVFFDKDQGAKGTILAIGGKYLAIRNGEPTGFNPFQMEPTAGNILFLEKLVQVL
VSRDGQHVTTTDESRISHAIRTVMRMRPELRHLSTVLQNVTEGSDRQDRENSVAKRLAKW
CFDDGTGKRGTFWWVLDCPQDQIDFNTHSNYGFDGTDFLDNADVRTPISMYLLHRMELAI
DGRRFIYWMDEAWKWVDDEAFSEFANNKQLTIRKQNGLGVFATQMPSSLLNSKVASALVQ
QVATEIYLPNPKADYHEYTDGFKVTNEEFDIIRSMSEESRMFLVKQGHHSMICRLELNGF
DDELAILSGSSDNNELLDQVIAEVGDDPSVWLPVFQERRKARIASSKSTGR
NT seq 2496 nt   +upstreamnt  +downstreamnt
atgggcgctcaatccaaatacgcgcaacagctcaataatgaacggtcacttgcaccgttc
attcccttcaggagccaggttggcccgaccaccgtgataacgcgtgacggtgatttcgtg
cgcacatggcgcatcgcgggcctggctttcgagacgcaggacaaggaggaactgttgatc
cgcaaggaccagcttaacaccttgttccgtgccatcgcctcaaacaatgtggcgctgtgg
tcccacaacgtacggcgcagaacctgggatcacttgaaatccttcttttccaatccgttc
tgcgacgctctcgacaagaagtattacggatcgttttccggctaccgaatgatgtcaaac
gaactgtatctgacggttatttaccggccagtgccggcgaagatcagcaggttgttcaac
gtggccgttcatcgttcgcatgcggaaatcttacaggagcagcagcttgccatccgcaag
ctggacgaaatcggcaatcaaattgaaaccagcttgcgtcgctacggtggcgatgacggg
cgtggcatcgaagtgctgagcacctatgaggacaaacacggcgcactgtgctcacagcag
cttgaattttataacttccttctctcaggcgaatggcagaaggtgcgcgtgccatcctgc
ccactggatgaatatctgggcaccgggtgggtgtatgctggcactgaaaccatcgagata
cgcaccgcgaacgcgacgcgctatgcgcgtggcatcgatttcaaggactatgcgagccac
accgagccgggcattttgaacggcctgatgtatagcgattacgagtacgtcatcacacaa
tccttcagcttcatgacaaagcgggatggcaaggagttcctgacacggcaaaagcagcgg
ctccaaaataccgaagacggtagcgcatcccagatcatggaaatggacattgccatcgac
cagctcggccggggcgatttcgtcatgggtgaatatcattattcgctgctggtatttgcc
gaagacatggagacggtgcgccacaacacatcacatgcgatgaacatcctgcaagacaat
ggttttctggcgacggtgatcgccacggccacggatgcggcgttctatgcacaactgcca
tgtaactggcggtatcggccgcgcgtggcgggcctgacctcgctcaacttcgccggtctg
tcatgtttccataatttccgcgcaggcaagcgggatggcaacccctgggggcaggcattg
acgctgcttaaaaccccttccggacagcccgcctacctgaacttccactattcaaaaggc
gacgaagacaacttcgacaagaagcttctgggcaatacccgcatcatcggccagtccggc
gctggtaaaactgtcctgatgaacttctgcctcgcgcaagcgcagaagtatttgcacaat
gctccgatgggtatgtgcaacgtctttttcgacaaggatcaaggcgcgaaagggactatt
cttgccattggcggcaaataccttgccatcaggaacggcgaacccaccgggttcaaccca
ttccagatggagccaacagcggggaacatcctgttccttgaaaaactcgtacaggtactg
gtatcgcgtgatggccagcacgtgaccacaacggacgaaagccggatcagtcatgccata
cgtacggtcatgcgcatgcgcccggagctgcggcatctgtcgacggtgctgcaaaacgtt
accgaaggcagcgaccgccaagatcgtgaaaacagcgtggcgaagcggctcgcgaagtgg
tgttttgatgacggcaccggcaagcggggcacattctggtgggtgctggattgcccgcaa
gaccagatcgacttcaacacgcatagcaattacggtttcgatggcaccgacttcctcgac
aacgccgacgtgcgtacgccgatttccatgtacctgctgcatcgtatggaattggctatc
gacgggcgtcgtttcatctactggatggacgaggcgtggaagtgggtagacgacgaagca
ttcagcgagttcgccaataacaagcagcttaccatccgcaagcaaaacggcctgggcgtg
tttgccacgcaaatgccctccagcctgctcaactccaaagtcgcgtcggccctggtgcaa
caggtggcaacggaaatctatctgccgaatccgaaagccgattatcacgagtacacggac
ggcttcaaggtgacgaacgaggagttcgacatcatccgcagtatgagcgaggaaagccgc
atgttcctggtcaagcaggggcatcattcgatgatttgccgcctggagcttaatggcttt
gatgacgaactggcgatcctctcaggcagctcggacaacaacgagttgctggaccaggtc
attgccgaagtcggggacgacccttcggtatggcttccggtgttccaggagcgccggaaa
gcacgcattgcgtcgtccaaatcaacaggaaggtga

DBGET integrated database retrieval system