KEGG   Brucella canis ATCC 23365: BCAN_B0071
Entry
BCAN_B0071        CDS       T00623                                 

Name
(GenBank) TraC protein
  KO
K03197  type IV secretion system protein VirB2
Organism
bcs  Brucella canis ATCC 23365
Pathway
bcs03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bcs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BCAN_B0071
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcs02044]
    BCAN_B0071
Secretion system [BR:bcs02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BCAN_B0071
SSDB
Motif
Pfam: TrbC DctQ T4SS_pilin
Other DBs
NCBI-ProteinID: ABX63273
UniProt: A9MDI5
Position
II:complement(65773..66090)
AA seq 105 aa
MKTASPSKKSLSRILPHLLLALIVSIAAIEPNLAHANGGLDKVNTSMQKVLDLLSGVSIT
IVTIAIIWSGYKMAFRHARFMDVVPVLGGALVVGAAAEIASYLLR
NT seq 318 nt   +upstreamnt  +downstreamnt
atgaaaaccgcttcccccagcaagaagtcgctgtcgcggattctacctcacctactgctg
gccctcattgtctccatcgctgcaatcgagcctaacctggcgcacgccaacggtggcctc
gataaggtaaatacaagcatgcaaaaagtgctggacttgctaagcggcgtatcgatcacc
atcgttaccatagccatcatctggtccggttacaagatggcattccggcacgcccgcttc
atggatgtagtgccggtgctgggcggcgccctggtggttggcgctgccgccgaaattgcc
tcttacctgcttaggtaa

DBGET integrated database retrieval system