KEGG   Brucella canis ATCC 23365: BCAN_B0072
Entry
BCAN_B0072        CDS       T00623                                 

Name
(GenBank) TraA protein
  KO
K03194  type IV secretion system protein VirB1
Organism
bcs  Brucella canis ATCC 23365
Pathway
bcs03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bcs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BCAN_B0072
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcs02044]
    BCAN_B0072
Secretion system [BR:bcs02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BCAN_B0072
SSDB
Motif
Pfam: SLT SLT_3 TraH_2
Other DBs
NCBI-ProteinID: ABX63274
UniProt: A9MDI6
Position
II:complement(66526..67242)
AA seq 238 aa
MVPFLVLAQQCAPTVAPQTMAAIVQVESGFNPYAIGVVGGRLVRQPVSLDEAITTAQSLE
AKGWNFSLGIAQVNRYNLPKYGSTYAQAFDPCKNLKMGSKILEDCYRRAIVKMPGQEQGA
LRAAFSCYYAGNFTGGFKTKPGSPSYVQKVVASADVTTKPIAVVPMIRKTPDAAAAVAAP
VKKRQPADRNSVLVDLHPSSQSMPATGAANAPVRLKTEQPATTDAPPGKDNTDGVVVF
NT seq 717 nt   +upstreamnt  +downstreamnt
atggtgccattccttgtcctcgcgcaacaatgcgcaccgactgttgcacctcagactatg
gcagcaatcgtgcaggtcgagtcgggcttcaatccttatgcaataggcgtcgttggtggg
cggttggtccgtcaacccgtttcccttgatgaagcaatcacgacagcacagtcactggaa
gccaaaggctggaatttctctttgggtattgctcaagtcaacaggtacaatctgccgaaa
tatggcagcacctacgcacaagcgttcgacccctgcaagaacctgaagatgggatccaag
atccttgaagactgctaccgtcgggccatcgtgaagatgcccggtcaggaacaaggcgcg
cttcgcgccgcattctcctgttactacgccggcaactttacgggcggcttcaagacgaag
cccggcagtcccagctacgtgcagaaggtcgtggcaagcgccgacgtgaccacaaagccg
attgctgtcgtgcccatgatccggaaaacgccggatgcggcggcagcagtagctgcccca
gtaaaaaaacgacagccggctgatcgtaattctgttcttgtcgatctgcatccatcatcg
cagtcgatgccagccaccggcgcggcgaacgcgcctgtaaggctgaagacagagcagccg
gcgacaaccgatgcgccgccagggaaggataatacggacggcgtagttgttttctaa

DBGET integrated database retrieval system