KEGG   Brucella canis ATCC 23365: BCAN_B0128
Entry
BCAN_B0128        CDS       T00623                                 

Name
(GenBank) Hypothetical protein
Organism
bcs  Brucella canis ATCC 23365
SSDB
Motif
Pfam: DUF1664 HIP1_clath_bdg DUF4763 CENP-H Fibin Syntaxin_2 betaPIX_CC DUF6468
Other DBs
NCBI-ProteinID: ABX63325
UniProt: A9MDN7
Position
II:complement(122269..122730)
AA seq 153 aa
MSLLLANVLSTLMALASLAALIVVGRKANETIRLGKVLALRVAAASNGLERAVKAIRNER
TDLTDASAKLDARLAETQRVRREMDEAIEELNRLRKALSRDMRQARILAETPPPRQEKTP
SAAEQPLPADKNALPVFVRRAVKKATVELAGQA
NT seq 462 nt   +upstreamnt  +downstreamnt
atgagcttgttgctggctaacgtgctttccacattgatggctcttgcctcgcttgcggct
ttgatcgtggtgggccgcaaggccaatgaaaccatcaggctcggcaaggtgctggcgctg
cgcgtcgccgccgcgtcaaacggtctggagcgcgccgtaaaggcgatccgcaacgaacgt
accgaccttaccgacgccagcgccaagcttgacgcccgccttgccgaaacgcagcgcgtg
cgccgtgaaatggacgaggcgatcgaggaattgaaccggctgcgcaaggcgctctcgcgc
gatatgcgccaggcgcgcatcttggccgaaacgccgccaccccggcaggagaaaaccccg
tccgccgcagaacaaccgctccccgcagacaagaacgcgctgcccgttttcgtgcgccgc
gcggtcaagaaggcaaccgttgaactggcgggacaggcatga

DBGET integrated database retrieval system