KEGG   Brucella canis ATCC 23365: BCAN_B0450Help
Entry
BCAN_B0450        CDS       T00623                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcs  Brucella canis ATCC 23365
Pathway
bcs00071  Fatty acid degradation
bcs00072  Synthesis and degradation of ketone bodies
bcs00280  Valine, leucine and isoleucine degradation
bcs00310  Lysine degradation
bcs00362  Benzoate degradation
bcs00380  Tryptophan metabolism
bcs00620  Pyruvate metabolism
bcs00630  Glyoxylate and dicarboxylate metabolism
bcs00640  Propanoate metabolism
bcs00650  Butanoate metabolism
bcs00900  Terpenoid backbone biosynthesis
bcs01100  Metabolic pathways
bcs01110  Biosynthesis of secondary metabolites
bcs01120  Microbial metabolism in diverse environments
bcs01130  Biosynthesis of antibiotics
bcs01200  Carbon metabolism
bcs01212  Fatty acid metabolism
bcs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCAN_B0450
   00630 Glyoxylate and dicarboxylate metabolism
    BCAN_B0450
   00640 Propanoate metabolism
    BCAN_B0450
   00650 Butanoate metabolism
    BCAN_B0450
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCAN_B0450
   00072 Synthesis and degradation of ketone bodies
    BCAN_B0450
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCAN_B0450
   00310 Lysine degradation
    BCAN_B0450
   00380 Tryptophan metabolism
    BCAN_B0450
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCAN_B0450
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCAN_B0450
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCAN_B0450
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcs04147]
    BCAN_B0450
Enzymes [BR:bcs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCAN_B0450
Exosome [BR:bcs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCAN_B0450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABX63631
UniProt: A9MB94
Position
II:complement(435953..437143)
Genome map
AA seq 396 aa AA seqDB search
MSKSDPIVIVGASRTPMGGFQGDFTNAQATDLGASAIGGALAGAGLAPEAVEEVIMGCVL
PAGQGQAPARQASLKAGLPLGTGATTVNKMCGSGMKAAMLAHDLILAGSADVIVAGGMES
MTNAPYLLPKARGGYRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYQFTREAQD
AFAISSLTRAQNAIKDGLFAAEITPVKVKSGRAEVEVTIDEQPGKAKLDKIPTLRPAFRE
GGTVTAANSSSISDGAAALLLMRASEAEKRGLTPHAVITGHATYADKPNLFSTAPIGAIR
KLSEKTGWDLKDVDLFEINEAFAVVAMAAMRDLDLPHDKVNIHGGACALGHPIGASGARI
LVTLLAALETHGLKRGIAGICLGGGEATAMGIERII
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagagcgatcctattgtcatcgtcggtgcttcgcgcacccccatgggcggtttt
cagggtgacttcacaaatgcgcaggcaaccgaccttggcgcttccgccatcggcggcgcg
cttgccggtgcaggccttgccccggaagccgtcgaggaggttatcatgggctgtgtcctg
cctgctggtcagggtcaggcgcctgcgcgtcaggcctcgctcaaggccgggctgccgctt
ggcaccggtgccacgaccgtcaacaagatgtgcggctcgggcatgaaggccgcgatgctt
gcccatgacctcatccttgccggttccgccgatgtcatcgtcgcgggcggcatggaaagc
atgacaaatgccccctatcttctgcccaaggcgcgcgggggctatcgcatgggccatgga
caggtgctcgaccatatgttcctcgatgggctggaagatgcctatgacaaggggcgcctg
atgggcacgtttgcggaagattgcgccgaggcctaccagttcacgcgcgaggcgcaggac
gcatttgcgatatcctccctgacccgcgcgcagaacgcgatcaaggatggtctttttgcg
gcggaaatcacgccggtcaaggtcaagtccggccgcgccgaggtggaagttaccattgac
gagcagccgggcaaggcaaagctggacaagatccccacgctgcgccccgccttccgcgaa
ggcggcacggtaacggcggccaattcctcttccatttccgatggcgcggcagcacttctg
ctcatgcgcgcatcggaggcagaaaaacgtggcctcaccccgcacgcggtcatcaccggc
cacgcaacctatgccgacaagccaaatctcttctccacggcccccattggcgcgatccgc
aaactgtctgaaaagactggctgggatttgaaggatgtcgatctcttcgagatcaatgaa
gcctttgccgttgttgccatggccgccatgcgcgatctcgacctgccgcacgacaaggtc
aatattcatggcggcgcctgtgcacttggccaccccatcggcgcatcgggcgcacgtatt
ctcgtaaccctgctggcggcacttgaaacacatggcctgaagcgcggcatcgcgggcatc
tgccttggcggcggcgaggcaaccgcaatgggtatcgaaaggatcatctga

DBGET integrated database retrieval system