KEGG   Brucella canis ATCC 23365: BCAN_B0452Help
Entry
BCAN_B0452        CDS       T00623                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcs  Brucella canis ATCC 23365
Pathway
bcs00010  Glycolysis / Gluconeogenesis
bcs00620  Pyruvate metabolism
bcs00640  Propanoate metabolism
bcs00680  Methane metabolism
bcs01100  Metabolic pathways
bcs01110  Biosynthesis of secondary metabolites
bcs01120  Microbial metabolism in diverse environments
bcs01130  Biosynthesis of antibiotics
bcs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAN_B0452
   00620 Pyruvate metabolism
    BCAN_B0452
   00640 Propanoate metabolism
    BCAN_B0452
  Energy metabolism
   00680 Methane metabolism
    BCAN_B0452
Enzymes [BR:bcs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BCAN_B0452
Lipid biosynthesis proteins [BR:bcs01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BCAN_B0452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABX63633
UniProt: A9MB96
Structure
PDB: 

Position
II:complement(437992..439662)
Genome map
AA seq 556 aa AA seqDB search
MTESPASARLDRYDDAVAQFDIAKAIALLAGNPDTGINACIECCDRYTGENRVALRAISI
DNTLTELTFEDLRDMSARVGNMLADAGISAGDVVAGLLPRTPELVATILGAWRIGAIYQP
LFTAFGPKAIEQRFGTSGAKLVVTNLANRSKLAEVENCPRVATILAPGESLPEGDIDFRA
AVAAASTECEPVMRKGSDLFMMMSTSGTAGLPKGVPVPLRALMAFGAYMRDAVGLRSDDI
FWNIADPGWAYGLYYAVTGPLLLGVPTILNEGGFTAENTYDIIERLGVTSLAGSPTAFRL
LIAAGPESAARVKGRLRVVSSAGEPLNPEVIRWFDACLGAPIHDHYGQTELGMVVNNHHG
LEHPVRQGSAGYAMPGYRVAVLDEAGKEVGPNEPGVLAIDIDNSPLLWFTGYYKKDTPSI
SGGYYRTGDTVEFEPDGSISFIGRADDVITSSGYRIGPFDVESALLKHPAVNEAAVVGVP
DPQRTEIVKAFVILAPGFEGTPELAEELALHVKKQLSAHAYPRQIDFVAELPKTPSGKIQ
RFLLRKAEVEKQQQQN
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaagccctgcttcagcacggctcgaccgctacgatgatgccgttgcgcagttc
gatattgcaaaagccattgcgcttcttgcaggaaatcctgatacgggtatcaatgcctgc
attgaatgctgcgaccgatatacgggcgaaaatcgcgtggcgctgcgcgccatttccatc
gacaatacgttgactgaactcacctttgaagacctgcgcgatatgtccgcgcgggtcggc
aatatgctggccgatgccgggatcagcgcaggcgatgtggttgccggtcttctcccccgc
acgcctgaactcgtcgccaccattctcggcgcctggcgcatcggcgcaatctatcagccg
cttttcaccgccttcggcccaaaagccatcgaacagcgtttcggcaccagtggcgccaaa
ctcgtcgtcaccaacctggccaatcgttccaaattggccgaagtggaaaactgcccccgc
gtcgcaaccattcttgcccccggtgaaagcctgccggaaggcgatatcgactttcgcgca
gccgtggcggcagcatcgaccgaatgcgagcccgtcatgcgcaagggcagcgaccttttc
atgatgatgtccacctccggcacggcgggcctgcccaaaggcgtcccggtgccgctgcgc
gccctgatggctttcggcgcctatatgcgcgatgccgtgggcctgcgcagcgacgatatt
ttctggaatatcgccgatccgggctgggcatatgggctttactatgccgtgacgggtccc
ctgcttctgggtgtgccgacgatcctgaacgaaggcggtttcaccgccgaaaacacctat
gacatcatcgaacgcctcggcgtgacgagccttgcgggctctccgactgccttccgcctg
cttatagccgccgggccggaatctgctgcccgcgtcaagggccgcttgcgcgtggtatcc
agcgcgggcgagccgctgaacccggaagtcattcgctggttcgatgcctgtcttggcgcg
ccgatccacgatcattacggccagacggaactgggcatggtggtgaacaaccatcatgga
ttggaacatccggtgcggcagggttcggcgggctatgccatgccgggctacagggttgcg
gttctggatgaagcgggcaaagaagtcggccccaatgaaccgggcgttctggccattgat
atcgacaattcgccgcttctctggttcaccggctattataaaaaggatacgccctccatc
tccggcggatattatcgcaccggcgatacggtggaattcgagccggatgggtctatcagc
ttcatcggccgcgccgatgacgtcatcacctcctccggctatcgcatcgggcctttcgat
gtggaaagcgcgcttctgaaacatcctgcggtcaacgaggctgcggtggtcggcgttccc
gatccgcaacgcaccgaaatcgtgaaggcctttgtcatcctggcccccggcttcgagggt
acgccggaactggcggaagaactggcgcttcacgtcaagaaacagctttccgcccatgcc
tatccgcggcagatcgactttgtggcggagcttcccaagacgccgagcggaaaaatacag
cgcttcctcctgcgcaaggcggaagtcgaaaagcaacagcaacagaattag

DBGET integrated database retrieval system