KEGG   Brucella canis ATCC 23365: BCAN_B1025Help
Entry
BCAN_B1025        CDS       T00623                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
bcs  Brucella canis ATCC 23365
Pathway
bcs00310  Lysine degradation
bcs01100  Metabolic pathways
bcs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    BCAN_B1025
Enzymes [BR:bcs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     BCAN_B1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Lycopene_cycl Pyr_redox_2 NAD_binding_8 FAD_binding_3 HI0933_like Amino_oxidase Mqo Thi4 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABX64168
UniProt: A9MCT1
Position
II:complement(992990..994222)
Genome map
AA seq 410 aa AA seqDB search
MADYDYCVIGGGIVGLATAKAVQEAEPGARIIVLEKESGLARHQTGHNSGVIHAGIYYQP
GSLKARLCRAGAQATKAFCKQYSIPFESCGKLLVATSALEMERMEALARRAVQNNIEFSH
LDQQALRKAEPAISGLGALFVPATGIVDYAKVSRAMAAEIVERGGIVRLNSPVTAIHEDE
KGVEVVSGGETVRASKLVACAGLQSDRIARLAGLDITHRIVPFRGEYYTLPQTRAGIVRH
LIYPIPDPDLPFLGIHLTRTIDGGVTVGPNAVLGFSREGYAKGSFHPGDIADMSFFAGFW
KMAMKNWRSAISEFGNSTSRARYLKQCRKYCPSLELSDLGAPGAGIRAQAVLDDGTLVHD
FLFKETERMLHVCNAPSPAATSSIPIGRMIAQKLLGINLQAEKDISVTGE
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtggcagattatgattattgcgtcatcggcggtggcattgtcgggcttgcgaccgcgaaa
gcggtgcaggaagccgagccgggcgcaagaattatcgttctggagaaggaaagcggcctt
gcccgtcaccagacgggacataatagcggcgtcattcatgcaggcatctattaccagccg
ggttcattgaaggcgcggctttgccgggcgggcgcacaggccaccaaagcgttctgcaag
caatattccattccctttgagagttgcggcaaacttctggtcgccacgtccgccttggaa
atggagcgcatggaggcgctggccaggcgcgcggtgcaaaacaatatcgaattcagccat
ctggaccagcaggcattgcgaaaggcggagcctgccatttccggcctgggggcgcttttt
gttcccgccaccggtatcgtggattacgcaaaggtctcgcgagccatggcagcggaaatt
gttgagcgaggcggcatcgtgcgtctcaattcgccggtgactgcaatccatgaggacgaa
aagggtgttgaagttgtttcgggtggcgagactgtgcgcgcttccaaactcgtcgcctgc
gccgggctgcaatcggaccgtattgcgcggctggccgggctcgacatcacccatcgcatc
gtgcccttccggggtgagtattataccttgccgcaaaccagggccggtatcgtcaggcac
ctgatctatcctattcccgatcccgacctgccgtttcttggcattcacctgacgcggacc
atcgatggcggtgtgacggttgggccgaatgccgttctgggtttctcgcgcgaaggctat
gccaagggcagtttccaccccggcgatatcgcggatatgtcgtttttcgcaggcttctgg
aaaatggcgatgaaaaactggcgctcggcaatatccgagttcggcaattcaacctcccgc
gcgcgctatctgaagcagtgccgcaaatattgtccgtcgctggagctttccgatctgggc
gcgccgggggccggcattcgtgcgcaggcggtgctggatgatggaacgctggtgcatgat
tttctgttcaaggaaaccgaacggatgctgcatgtgtgcaatgcgccatcgccagccgca
acctcatctattcccatcgggcgcatgattgcgcaaaagcttctggggataaacttgcag
gcggaaaaggatatatccgtaaccggcgaatga

DBGET integrated database retrieval system