KEGG   Burkholderia cepacia GG4: GEM_1012Help
Entry
GEM_1012          CDS       T02205                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00010  Glycolysis / Gluconeogenesis
bct00053  Ascorbate and aldarate metabolism
bct00071  Fatty acid degradation
bct00280  Valine, leucine and isoleucine degradation
bct00310  Lysine degradation
bct00330  Arginine and proline metabolism
bct00340  Histidine metabolism
bct00380  Tryptophan metabolism
bct00410  beta-Alanine metabolism
bct00561  Glycerolipid metabolism
bct00620  Pyruvate metabolism
bct00625  Chloroalkane and chloroalkene degradation
bct00903  Limonene and pinene degradation
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
bct01120  Microbial metabolism in diverse environments
bct01130  Biosynthesis of antibiotics
Module
bct_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GEM_1012
   00053 Ascorbate and aldarate metabolism
    GEM_1012
   00620 Pyruvate metabolism
    GEM_1012
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GEM_1012
   00561 Glycerolipid metabolism
    GEM_1012
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GEM_1012
   00310 Lysine degradation
    GEM_1012
   00330 Arginine and proline metabolism
    GEM_1012
   00340 Histidine metabolism
    GEM_1012
   00380 Tryptophan metabolism
    GEM_1012
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GEM_1012
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GEM_1012
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GEM_1012
Enzymes [BR:bct01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     GEM_1012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF742
Motif
Other DBs
NCBI-ProteinID: AFQ47459
UniProt: J7J526
Position
1:complement(1110279..1111718)
Genome map
AA seq 479 aa AA seqDB search
MEEAKHFIAGEWTLPAQLETIPVVDPSDGQPFATIARGTAPDIERAVAAARDAFAGPWGA
ASAAERGRVLMRLSARVADSLEELATIEARDTGKPLKQARADAAALARYFEFYAGAADKL
HGETLPYQAGYTVLTVREPHGVTGHIVPWNYPMQIFGRSVGAALAAGNACVVKPAEDACL
SVLRVAELAAEAGLPAGTLNVVTGYGHEAGAALARHPGIDHISFTGSPATGKLVTQMAAE
NHVPVTLELGGKSPQIVFADADLEAALPVLVAAIVQNGGQTCSAGSRVLIERAVYEPLVE
RLATAFNGLRVGPSRADLDCGPLINAKQQQRVWDFLSDAQHDGIPMAGHGQVVADAPESG
FYQAPALLRDVPPSHRLAQEEVFGPVLAAMRFVDEDEAVALANGTPYGLVAGIWTRDGAR
QMRLARRLRAGQVFINNYGAGGGVELPFGGVGHSGHGREKGFEALYGFTALKTIAIRHG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcgaagcacttcatcgcaggcgaatggacgttgcccgcgcaactggagacg
attccggtcgtcgatccatccgacggccagccgttcgcgacgatcgcacgcggcacggcg
cccgacatcgagcgcgcagtcgccgcggcccgcgatgcgttcgcgggcccgtggggcgcg
gcaagcgccgccgagcgcggccgcgtgctgatgcgactgtcggcgcgcgtcgccgactcc
ctggaagaactcgcgacgatcgaggcgcgcgacaccggcaagccgctgaagcaggcccgc
gccgacgccgccgcgctcgcgcgctacttcgagttctacgcgggcgccgccgacaaactg
cacggcgagaccctcccctatcaggccggctacacggtgctgacggtgcgcgagccgcac
ggcgtcaccggccacatcgtgccgtggaactacccgatgcagatcttcgggcgcagcgtc
ggcgcggcgctcgcagccggcaacgcgtgcgtcgtgaagccggccgaggatgcgtgcctg
tcggtgctgcgcgtcgccgagctggccgccgaagccgggttgccggccggtacgctcaac
gtcgtcaccggctatggccatgaagccggcgccgcgctcgcgcgccatcccggcatcgac
cacatctcgtttacgggctcgcccgcgaccggcaagctggtcacgcagatggcggcggag
aaccacgtgcccgtcacgctcgagctcggcggcaagtcgccgcaaatcgtgttcgccgac
gccgatctcgaagcggcgctgcccgtgctggtggcggcgatcgtgcagaacggcgggcag
acctgctcggccggcagccgcgtgctgatcgagcgcgcggtctacgagccgctcgtcgaa
cggctcgccaccgccttcaacgggctgcgggtcggcccaagccgggccgacctcgactgc
ggaccgctgatcaacgcgaagcagcagcagcgcgtctgggatttcctgtccgacgcgcag
cacgacggcattccgatggccgggcacggccaggtcgtcgccgatgcgcccgaaagcggc
ttctaccaggcacccgcgctgttgcgcgacgtgccgccgtcgcaccggctcgcgcaggag
gaagtgttcggcccggtgctcgccgcgatgcggttcgtcgacgaagacgaagcggtcgcg
ctggcgaacggcacgccgtatggcctcgtcgcgggcatctggacccgcgacggcgcgcgc
cagatgcgtctcgcgcggcgcctgcgcgcgggccaggtgttcatcaacaactacggcgcg
ggcggcggcgtcgagctgccgttcggcggcgtcggccactcgggccacggccgcgagaaa
ggcttcgaggcgctgtacggcttcaccgcgctgaagacgatcgcgatccggcacggctga

DBGET integrated database retrieval system