KEGG   Burkholderia cepacia GG4: GEM_1292Help
Entry
GEM_1292          CDS       T02205                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00010  Glycolysis / Gluconeogenesis
bct00020  Citrate cycle (TCA cycle)
bct00620  Pyruvate metabolism
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
bct01120  Microbial metabolism in diverse environments
bct01130  Biosynthesis of antibiotics
bct01200  Carbon metabolism
Module
bct_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GEM_1292
   00020 Citrate cycle (TCA cycle)
    GEM_1292
   00620 Pyruvate metabolism
    GEM_1292
Enzymes [BR:bct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GEM_1292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N NQRA HlyD_D23 DUF4813 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: AFQ47728
UniProt: J7J8W4
Position
1:1406823..1408499
Genome map
AA seq 558 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEVLVKVGDTVEPEQSLVTLESDKATMDVPSPAAGTVKEV
KIKVGDSVSEGSLIILLDGGAAAQVNGAAAPAAAPAPAAAPAPVAAAPAAAAPAAAATAA
APAASGGTLEVKVPDIGDYKDVPVIEIGVKVGDTVEKEQSLVTLESDKATMDVPSPAAGV
VKEIKVKVGDSVSEGTLIVLLDAVGAPAAAAPQASAPAPAAAAPAPAAAPAPAQAAPAPA
AAAPAAASSGEYRASHASPSVRKFARELGVEVARVQGTGPKGRITKEDVTGFVKGVMTGQ
RAAPAAAAAPAGGGELNLLPWPKVDFSKFGPFEAKPLSRIKKISGANLHRNWVMIPHVTN
NDEADITELEALRVQLNKEHEKAGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLVFKQ
YYHVGFAADTPNGLVVPVIRDADKKGLVDIAKEMAELSKAARDGKLKPDQMQGGCFSISS
LGGIGGTNFTPIINAPEVAILGLSRGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEAA
RFNAYLGALLADFRRIIL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtgaaggtgccggatatcggcgattacaaggacgtgcccgtc
atcgaggtgctcgtcaaggtgggtgacacggtcgagcccgagcagtcgctcgttacgctc
gagtcggacaaggcgacgatggacgtcccgagcccggcagccggcacggtcaaggaagtg
aagatcaaggtcggcgattccgtgtcggaaggctcgctgatcatcctgctcgacggcggc
gccgcggcgcaggtgaacggcgcggccgcgccggcagcagccccggctccggcggcagcg
ccggcgccggttgccgcagcaccggctgccgcagcaccggctgccgcagcaacggctgcc
gctcccgctgcatcgggcggcacgctcgaggtcaaggtgcccgacatcggcgactacaag
gacgtcccggtgatcgagatcggcgtgaaggtcggcgacacggtcgagaaggagcagtcg
ctcgtcacgctcgagtcggacaaggcgacgatggacgtgccgagcccggccgccggcgtc
gtgaaggaaatcaaggtcaaggtgggcgactcggtgtcggaaggcacgctgatcgtgttg
ctcgacgccgtcggtgcaccggctgctgccgcaccgcaggcaagcgcaccggctccggcc
gctgctgcgccggctccggctgccgcgccggcacccgcgcaggctgcaccggctccggct
gccgccgcgccggctgccgcgtcgtcgggcgagtaccgcgcgagccacgcatcgccgtcg
gtgcgcaagttcgcgcgcgaactcggcgtcgaggtcgcacgcgtgcagggtaccggtccg
aagggccgtatcacgaaggaagacgtcaccggcttcgtgaagggcgtgatgacgggccag
cgcgcagcgccggccgctgcagccgcgccggcaggcggtggcgagctgaacctgctgccg
tggccgaaggtcgacttctcgaagtttggcccgttcgaggcgaagccgctgtcgcgcatc
aagaagatctcgggcgcgaacctgcatcgcaactgggtgatgatcccgcacgtcacgaac
aacgacgaagcggacatcaccgagctcgaagcactgcgcgtgcagctgaacaaggagcac
gagaaggcgggcgtgaagttcacgatgctcgcgttcgtgatcaaggcggtcgtcgcggcg
ctgaagaagttcccgaccttcaatgcgagcctcgacggcgacaacctggtgttcaagcag
tactaccacgtcggtttcgccgccgacacgccgaacggtctcgtcgtgccggtgatccgc
gatgcggacaagaaggggctcgtcgacatcgcgaaggaaatggccgagttgtcgaaggcc
gcgcgcgacggcaagctgaagccggaccagatgcagggcggctgcttctcgatctcgtcg
ctcggcgggatcggcggcaccaacttcacgccgatcatcaacgcgccggaagtcgcaatc
ctcgggttgtcgcgcggccagatgaagccggtgtgggacggcaagcagttcgtgccgcgt
ctgacgctgccgctgtcgctgtcgtatgaccatcgcgtcatcgatggcgcggaagccgcg
cggttcaatgcgtatctcggcgcgttgcttgccgatttccgtcgcatcattctttga

DBGET integrated database retrieval system