KEGG   Burkholderia cepacia GG4: GEM_1557Help
Entry
GEM_1557          CDS       T02205                                 

Definition
(GenBank) putative integral membrane transport protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bct  Burkholderia cepacia GG4
Brite
KEGG Orthology (KO) [BR:bct00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    GEM_1557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AFQ47982
UniProt: J7J1E2
Position
1:1690689..1691699
Genome map
AA seq 336 aa AA seqDB search
MHSIQLALWMVATLVLVALVFDFMNGFHDAANSIATVVSTGVLKPQQAVVFAAAFNVIAY
FIFHLKVAQTVGKGTIDPEIVDHYVVFGALVGAIGWNVITWYYGIPSSSSHALIGGLVGA
ALAKSGWSSLNIDGLLKTIAFIFISPLLGFILGSLFMLGVSWLYFRTAPSKVDRRFRRLQ
LLSAGLYSLGHGGNDAQKTIGIIWMLLIASGYASATADAPPAWVIGACYLSMGLGTLFGG
WRIVRTMGQKITKLKPVGGFCAESGGAITLFIASFLGIPVSTTHTITGAIVGVGATQKLS
AVRWGVAGNIVWAWVLTLPASALFAAGGWWLGHQIF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcattcgatacaactcgccctatggatggtcgcgacgctggtgctcgtcgcgctcgta
ttcgacttcatgaacggctttcacgacgcagcgaactcgatcgccaccgtcgtgtcgacc
ggggtgctgaagccccagcaggccgtggtgttcgcggccgcgttcaacgtcatcgcgtat
ttcatcttccacctgaaggttgcacagacggtcggcaaaggcacgatcgatcccgagatc
gtcgaccactatgtcgtgttcggcgcgctggtcggtgcgatcggctggaacgtgatcacc
tggtactatgggatcccgtcgagctcgtcgcacgcgctgatcggcggcctcgtcggcgcg
gcgctcgcgaagtcgggctggagctcgctgaacatcgacgggctgctgaagacgattgcg
ttcatcttcatttcgccgctgctcggtttcatcctcggttcgctgttcatgctcggcgtg
tcgtggctgtacttccgtaccgcgcccagcaaggtcgaccggcgcttccgccggctgcag
ctgctgtcggctggcctgtacagcctgggccacggcggtaacgacgcgcagaagacgatc
ggcatcatctggatgctgctgatcgcgagtggctacgcgtcggcaaccgccgatgcgccg
ccggcatgggtgatcggcgcatgctacttgtcgatgggtctcggcacgctgttcggcggc
tggcgcatcgtgcgcacgatgggccagaagatcacgaagctcaagccggtcggcggtttc
tgtgccgaaagcggcggggcgatcacgctgttcatcgcgtcgttcctcggcattccggtg
tcgaccacgcacacgatcaccggtgcgatcgtcggtgtcggcgcgacgcagaagctgtcg
gccgtgcgctggggcgtcgccggcaacatcgtctgggcctgggtgctgacgctgccggcg
tccgcgttgttcgcggccggcggatggtggctcggacaccagatcttctga

DBGET integrated database retrieval system