KEGG   Burkholderia cepacia GG4: GEM_2076
Entry
GEM_2076          CDS       T02205                                 

Definition
(GenBank) rhs element vgr
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bct  Burkholderia cepacia GG4
Pathway
bct03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bct00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    GEM_2076
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bct02044]
    GEM_2076
Secretion system [BR:bct02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GEM_2076
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V
Other DBs
NCBI-ProteinID: AFQ48493
UniProt: J7JB26
Position
1:complement(2264523..2267327)
AA seq 934 aa
MSTQSDLIQAFFGGRSQHDRFLWLTTPLGADKLVAESLHGWESLDRGGFRFQVTALTERP
DVPLDKLIGAPILVEWQAADGQDARRPFHGHVTAAELVGYNGGLARVRLVVEPWLALLQQ
RVDSYNFVNASVVDISEQIFAHYARGAIVPAWRWALADPAKYAKRSLTAQAGEADFAFLE
RLWAEEGIFYWFEHEGDAHSASLGKHTLVLSDTNERFAPAEPERVGFHQTSDGDPRGGIR
QFLNARRWRIGSVARASWDHRSLSTRPAGVRATGAAVPGEDRDVAGPYAFQTAAIGDQRA
QQQLDAQRVAALQAEGSGTRRDLRPGLRFAMSNHPSLDASHAFVCLRVEHDARANVGADV
HGAIAQRLGGIPPLLDATPGGYGSAQALHAAFDATTHDGGALMDGDEVYRNRFAALPFDQ
AYRPLAPDGHGARVHPVAVMPGPQTTIVVGAGDPLHTERDHRIRIQHHAQRGQNSASRED
HPRTANAPADRGAGTWTRMVTPVGGDNWGGVSVPRVGQEVWTEWLEGQPDRPVAVAALYN
GQGNTDAQHNALAGGPSSSTANAAAWFAGNDHAAVLTGFKTQDMSASQTGAAGSRQFMLD
DTAGQASARLATTDHDSGLTLGHIKQVQDNRRLADRGYGAELSTQAAGALRAGAGLLIST
APGVNQMDASAASQVLAQQREMLQGLADFARKQGAEPGASAAQPGTAAAGGATPPLAAID
GLQQSQASIGATREGSGAGGAGGGGAVAWKHPHLVAHGAAGVAALTAQSHVWTSGTQTVL
SAGRDVQVTVQGKSSIVAKEGIALYTHGTAGGSRPVPAAGIALHAATGAVTVQAQNAGTL
DANAQRTVTVSSAQASVVLQSPKRLLLTAANAFLKMEGNDIVIGAPGKATFHAAQHTLTG
PRSANVQLPSMNKPACVECMRDLAHRHEAIATRG
NT seq 2805 nt   +upstreamnt  +downstreamnt
atgtcgacccaatctgatctcatccaggcatttttcggcggccggtcgcagcacgaccgg
tttttgtggctgaccacgccgctcggcgcggacaagctcgtcgccgagagcctgcacgga
tgggagtcgctcgatcgcggcggcttccggttccaggtcaccgcgctgaccgagcgtccc
gacgtgccgctcgacaagctgatcggtgcgccgatcctcgtcgaatggcaggccgcggac
gggcaggacgcaaggcgcccgttccacggccacgtgaccgccgccgaactcgtcggctac
aacggcgggctcgcgcgcgtgcggctcgtggtcgaaccgtggctcgcgctgctgcaacaa
cgcgtcgacagctacaacttcgtgaacgcgagcgtcgtcgacatcagcgagcagatcttc
gcgcactacgcgcgtggcgcgatcgtgccggcgtggcgctgggcgctcgccgaccccgcc
aaatacgcgaaacgcagcctgaccgcgcaggccggcgaagcggacttcgcgtttctcgaa
cgactgtgggccgaagaaggcatcttctactggttcgaacatgaaggcgacgcgcactcg
gcgagcctcggcaagcacacgctcgtcctcagcgacacgaacgagcggttcgcgcccgct
gaacccgaacgcgtcggcttccatcagacgagcgacggcgatccgcgcggcggtatccgg
cagttcctgaacgcacgccgttggcgcatcggcagcgtcgcgcgcgcgagctgggatcat
cgcagcctgtcgacgcgtccggccggcgtgcgcgcgaccggcgcggcggtgccgggcgag
gatcgcgatgtcgccggcccgtacgcgttccagaccgccgcgatcggcgaccagcgcgcg
cagcagcaactcgatgcacagcgcgtggcggcgttgcaggccgaaggcagcggcacgcgt
cgcgatctgcgcccggggctgcgcttcgcgatgtcgaatcatccgtcgctcgacgcatcg
cacgcgttcgtgtgcctgcgcgtcgagcacgacgcgcgggcgaacgtgggcgccgacgtg
cacggcgcgatcgcgcaacggctcggcggaattccgccgctgctcgatgccacgcccggc
gggtacggcagcgcgcaggcgctgcatgcggcgttcgacgcgacgacgcacgacggcggc
gcgctcatggacggcgacgaggtgtaccggaaccgcttcgccgcgttgccgttcgaccag
gcctatcggccgctggcgccggacggacacggtgcgcgcgtgcatccggtcgcggtgatg
cccggcccgcagacgacgatcgtggtcggcgcgggcgacccgctccataccgagcgcgat
caccggatccggatccagcatcacgcgcagcgcggacagaattcggcgagtcgcgaggac
catccgcgcaccgcgaatgcgccggccgatcgcggcgccggcacctggacgcgcatggtg
acgccggtgggcggcgacaactggggcggcgtgagcgtgccgcgcgtcggccaggaagtc
tggaccgaatggctcgaaggccagccggaccggccggtcgcggtcgccgcgctctataac
gggcagggcaacacggatgcgcagcacaatgcgctggcgggcggtccgagcagcagcacg
gccaacgcggcggcgtggtttgccggcaatgaccatgcggccgtgctgaccggtttcaag
acgcaggacatgagcgcgagtcagaccggtgcggccggctcgcgtcaattcatgctcgac
gacacggccggccaggcgagtgcgcgcctggccacgaccgatcacgacagcggcctgacg
ctcgggcacatcaagcaggtgcaggacaaccggcgtctggccgatcgcggctacggcgcc
gaactgtcgacgcaggcggccggtgcgctgcgcgctggcgccggtttgctgatcagcacg
gcgcccggcgtgaaccagatggacgcgagcgccgcgagccaggtgctcgcgcagcaacgc
gagatgctgcaggggctcgcggatttcgcgcgcaagcagggcgcggagccgggcgcgagc
gcggcgcagcccggtacggcagccgccggcggcgcgacgccgccgctcgccgccatcgac
gggttgcagcagagccaggcgtcgatcggcgcgacgcgcgaaggcagcggcgcgggcggt
gccggcggcggcggtgcggttgcgtggaagcatccgcatctcgtcgcgcacggtgcggcc
ggcgtcgccgcgctgacggcgcagagccacgtctggacctcgggtacgcaaaccgtgctg
agtgccggacgcgacgtgcaggtcacggtccagggcaagtcgagcatcgtcgcgaaggaa
ggcatcgcgctgtacacacacggcacggcgggcggcagtcgcccggtgccggccgccggc
atcgcgctgcacgcggcgacgggcgccgtcaccgtgcaggcgcagaacgccgggacgctc
gacgccaatgcgcagcgcacggtgacggtgtcgagcgcgcaggcgagcgtcgtgctgcag
tcgccgaagcggctgctgctgacggccgccaacgcattcctgaagatggaaggcaacgac
atcgtgatcggcgcaccgggcaaggcgaccttccatgcggcccagcacacgctgaccggc
ccgcgttccgcgaacgtgcagttgccgtcgatgaacaagcccgcgtgcgtcgaatgcatg
cgggatctcgcgcatcgccacgaagcgatcgccacgcgcgggtga

DBGET integrated database retrieval system