KEGG   Burkholderia cepacia GG4: GEM_2081
Entry
GEM_2081          CDS       T02205                                 

Definition
(GenBank) secreted protein hcp
Organism
bct  Burkholderia cepacia GG4
SSDB
Motif
Pfam: DUF2235
Other DBs
NCBI-ProteinID: AFQ48498
UniProt: J7JB30
Position
1:complement(2274128..2276527)
AA seq 799 aa
MSFRFASADRQDVGVVTKAEQDAIMRRLHDDDGMSCCKTLHVGIFFDGTRNNADRDRSGG
KHSNVARLFDVFPRDKYHSAIYVAGVGTPFVDEIGDQGVGLQAAAGAAAGWAGEGRINWA
LLQLHNVVHALAFGNSLSAALGKSDKALAKAVSVDLNFKGIDLGGTPPKPGSLGDINARG
SSSVGALKLMAAEQNGIELTWDRDTLWAQLKGEVDTANWTATMRAWDEKRRTALRARCAQ
LKERVGDLLVKGKPKLQRIRLYVFGFSRGAAEARTFSNWLADALDPDFSLCGVPVSYDFL
GIFDTVASVGIAQGTAATLFDGHGGWGRKELMGVPYYVRRCVHMVAAHEPRGSFPLDLID
ASLDGREEIVYPGVHSDVGGGYGPGEQGRGTGDADKLSQVPLLDMYREARKAGVPLDIKG
PGVAAEAAAAFAISPGLKRAFSAYVSTSADYYYAKEHGTPGLMRAHYGLYLRWRKMRLDN
LRTQPSFLAAKAAYPQDAVDLDSANEELRLEWRDLLECEKEGGPTVSRYAGNAVSRKITQ
NPKAAAVISPAVLPIAAGLQSAIPFVGPVVRASAKRAEDFFQLQLDEKWQQWLEVRGDWN
MGPPEAPISALYDNFMHDSRAWFKPLGDDDDVWNHNQIKALQTRQAEFERQHAEWKKRQQ
LGVPGPSQIMQMMGAGALGLGPAANIAPEPEPRSPLTAQQADILKRYDAAQRAAQNARAA
RDATAPTDSAVLTDPKVTGGLALQDAGREFSFVWGYLRWRTVYVNGVRWDAPHVPTVQED
MEAMRQQMQRNVDMSKLFR
NT seq 2400 nt   +upstreamnt  +downstreamnt
atgagcttccgattcgcgagcgcggaccggcaggacgtcggggtcgtgaccaaggcggag
caggacgcgatcatgcgccggctccacgacgacgacgggatgagctgctgcaagacgctg
catgtcggcatcttcttcgacggcacgcgcaacaacgccgatcgcgatcgctcgggcggc
aagcacagcaacgtcgcgcgtctgttcgacgtgtttccgcgcgacaagtatcacagcgcg
atttacgtggcgggcgtcggtacaccgttcgtcgacgagatcggcgaccagggcgtcggc
ctgcaggccgcggcgggtgccgcggcgggatgggccggcgagggccgcatcaactgggca
ctgctgcagctgcacaacgtcgtgcatgcgctcgcgttcggcaattcgctgtccgcggcg
ctcggcaagagcgacaaggcgctcgcgaaggccgtcagcgtcgacctgaatttcaagggc
atcgatctcggcggcacgccgccgaagccgggcagcctcggcgacatcaacgcgcgcggc
agttcgagcgtcggcgcgctcaagctgatggcggccgagcagaacggcatcgagctgacc
tgggaccgcgacacgctctgggcgcagctcaagggcgaggtcgataccgcgaactggacc
gcgacgatgcgtgcgtgggacgagaagcggcgcaccgcgctgcgggcccgctgcgcgcaa
ctgaaggagcgcgtgggcgatctgctggtcaagggcaagccgaagctgcagcgcatccgc
ctgtacgtgttcggtttctcgcgcggtgcggccgaggcccgcacgttctcgaactggctg
gccgatgcgctggaccccgatttcagcctgtgcggcgtacccgtgtcgtacgactttctc
ggcatcttcgatacggtcgcgtcggtcggcatcgcgcagggcaccgccgcgacgctgttc
gacgggcatggcggctgggggcgcaaggaactgatgggggtaccgtactacgtgcgccgt
tgcgtccacatggtcgccgcccacgagccgcgcggatcgttcccgctcgacctgatcgat
gcgtcgctggacgggcgcgaggagatcgtctatccgggcgtgcattcggacgtcggcggc
ggttacgggccgggcgagcaggggcgaggcaccggcgatgcggacaagctgtcgcaggtg
ccgctgctcgacatgtatcgcgaagcgcgcaaggccggcgttccgctcgatatcaagggg
cccggtgtcgcggccgaagcggcggcggcgttcgcgatttctcctggactcaagcgggcg
ttttcggcgtacgtgagcacgagcgcggactactactatgcaaaggagcacggcacaccg
ggcctgatgcgcgcgcactatgggctttacctgcgctggcgcaagatgcggctcgacaac
ttgcgtacgcaaccgtcgtttctcgccgccaaggccgcctatccgcaggatgcggtcgat
ctcgacagcgcgaacgaggagctgcggctcgaatggcgcgacctgctcgaatgcgagaaa
gaaggcggcccgaccgtgagccgatacgcgggcaacgcggtcagccggaagatcacgcag
aacccgaaggcggcggccgtcatttcgccggccgtcctgccgatcgccgcgggcctgcag
tccgcgattccgttcgtcggcccggtggtgcgcgcaagtgccaagcgcgccgaggatttc
ttccagctgcagctcgacgagaaatggcagcagtggctcgaggtgcggggcgactggaac
atggggccgccggaagcgccgatcagtgcgctgtacgacaacttcatgcatgactcgcgc
gcgtggttcaagccgcttggcgacgacgacgacgtgtggaaccacaaccagatcaaagcg
ctgcaaacccgccaggccgagttcgagcgccagcatgccgagtggaagaagcgtcagcaa
ctcggcgtgcctggaccgtcacagatcatgcagatgatgggggcgggcgcgctcggcctc
gggccggccgccaacattgcgccggagcccgaaccgcgttcgccgctgaccgcacaacag
gccgacatcctgaaacgctacgacgccgcgcagcgggccgcgcagaatgcccgcgcggca
cgggatgcaaccgcgccgaccgacagcgccgtcctgaccgacccgaaagtcaccggcggt
ctcgcgctgcaggatgcggggcgcgagttctcgttcgtctggggctacctgcgctggcgc
accgtctacgtgaacggcgtgcgctgggatgcgccgcacgtgccgaccgtgcaggaagac
atggaggcgatgcgccagcagatgcagcgcaacgtcgacatgagcaagctgttccgatga

DBGET integrated database retrieval system