KEGG   Burkholderia cepacia GG4: GEM_2659Help
Entry
GEM_2659          CDS       T02205                                 

Definition
(GenBank) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00240  Pyrimidine metabolism
bct00250  Alanine, aspartate and glutamate metabolism
bct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    GEM_2659
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GEM_2659
Enzymes [BR:bct01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     GEM_2659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AFQ49058
UniProt: J7JCM7
Position
1:complement(2898215..2899246)
Genome map
AA seq 343 aa AA seqDB search
MTTDTTGRTGNPAAAASPERFRYGFLKGNPQLTKNGELKHLLSIEGLPRSIVNHILDTAE
QFVSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAATRLSADVLNLNINASSTSKG
ESLLDTINNLSAMHADLFVVRHASSGAPYLIAEHCAPHVHVINAGDGRHAHPTQGLLDMY
TIRHYKRDFTKLRVAIVGDILHSRVARSDIHALTTLGVPEVRAIGPRTLLPGGLEQMGVK
VYHNLDEGLKGVDVIIMLRLQNERMSGALLPSAQEYFKTWGLTPERLALAAPDAIVMHPG
PMNRGVEIDSQVADGPQSVILNQVTFGIAVRMAVMGIVAGNSD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgacaccactggccgcaccggcaatcctgctgcggccgcgagccccgagcgg
ttccgctacggtttcctgaagggcaacccgcagctcacgaaaaacggcgagctgaaacac
ctgctgtcgatcgagggcctgccgcgctcgatcgtcaaccacatcctcgatacggccgag
cagttcgtcagcgtgacggaccgcgaggtgaagaaggtgccgctgctgcgcggcaagtcg
gtgttcaacctgttcttcgagaactcgacgcgcacgcgcacgaccttcgagatcgccgcg
acgcgcctgtcggccgacgtgctgaacctgaacatcaatgcgtcgtcgacgagcaagggc
gagtcgctgctcgacacgatcaacaacctgtcggcgatgcatgccgacctgttcgtcgtg
cgccatgcgtcgagcggcgcgccgtacctgatcgccgagcactgcgcgccgcacgtgcac
gtgatcaacgccggcgacggccgtcatgcgcacccgacgcagggcctgctcgacatgtac
acgatccgtcactacaagcgcgacttcacgaagctgcgcgtggcgatcgtcggcgacatc
ctgcattcgcgcgtcgcgcgctccgacatccacgcgctcaccacgctcggcgtgccggaa
gtgcgcgcgatcggcccgcgcacgctgctgccgggcggtctcgagcagatgggcgtgaag
gtgtaccacaacctcgacgaagggctgaagggcgtcgacgtgatcatcatgctgcgcctg
cagaacgagcggatgagcggcgcgctgctgccgtccgcgcaggagtacttcaagacctgg
ggcctgacgccggagcgcctcgcgcttgccgcgcccgacgcgatcgtgatgcaccccggc
ccgatgaaccgcggcgtcgagatcgactcgcaggtcgccgacgggccgcagtccgtgatc
ctcaaccaggtcacgttcggcatcgccgtgcggatggcggtgatgggcatcgtcgccggc
aacagcgactga

DBGET integrated database retrieval system