KEGG   Burkholderia cepacia GG4: GEM_3040Help
Entry
GEM_3040          CDS       T02205                                 

Definition
(GenBank) type vi secretion system protein
  KO
K11896  type VI secretion system protein ImpG
Organism
bct  Burkholderia cepacia GG4
Brite
KEGG Orthology (KO) [BR:bct00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bct02044]
    GEM_3040
Secretion system [BR:bct02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GEM_3040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: AFQ49436
UniProt: J7JEP6
Position
1:complement(3325764..3327599)
Genome map
AA seq 611 aa AA seqDB search
MEELLPYYERELSFLRRYSRDFAERYPKIAARLALSGEHCEDPHVERMIESFALLGARIN
KKLDDDYPEFTEALLEVLYPHYLRPFPSCSIAQFTPASPGQQTEPVVIDRGTELKSRPIR
GVQCRFRTAYDVTLAPIRISEARYTPVALAPSATVLPSNATGVISITFESLAAQLDLGAL
KLSTLRAHLHGEQSFVAALTDCLFVHVLGAYVEPERNGRWTALRKLPIAQAGFDEDDALI
DYPAKSHPAYRLLTEYFAFPDKFDFVDFDLAAIARASGRCQRATLHLVLQDVRSDSHVAR
LLELLTASHFRLFCTPIVNLFRQHGEPIRITHRAVSYPVIAEARRAFAYEVYSIDSVKLV
RQQAHEESVIEFRPFYSLHHGESARIGHYWFARRNDWVAQKSPGYETEISIVDIDFEPTS
PQTDTLSLDLTCTNRDLPAMLAFGLEGGDLFQDGGAQTSGISLLRRPTQSVRFERGRAAH
WRLVSHLALNHVSLVAHGLAPLKEMLTLYDLRRTAVSMRQIDGLAGVEQRGAVQWLPGKP
FATFVRGIEIRLTIDEEHFVGASLASFVRVLDSFFGLYVHLNSFVQLVVVSKRTGEEIIR
CKPRTGESILA
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggaagaattgctgccgtattacgagcgcgaattatcgtttttgcggcgctattcgcgg
gatttcgccgaacgttatccgaagatcgcggcgcggctcgcgttgtccggcgagcactgc
gaggatccgcacgtcgagcggatgatcgagtcgttcgcgctgctcggcgcgcgcatcaac
aagaagctcgacgacgactaccccgaattcaccgaagcgctgctggaagtgctgtatccg
cactacctgcggccgttcccgtcgtgctcgatcgcgcagttcacgccggcttcgcccggc
cagcagaccgaaccggtcgtgatcgaccgcggcaccgagctgaagagccgcccgatccgc
ggcgtacagtgccggttccgcaccgcatacgacgtgacgctggcgccgatccgcatctcg
gaggcgcgctacacgccggtcgcgctcgcgccgagcgcgacggtgctgccgtccaacgcg
acgggcgtgatctcgatcacgttcgaatcgctcgccgcgcagctcgatctcggcgcgctg
aagctgtcgacgctgcgtgcgcacctgcacggcgaacagtcgttcgtcgccgcgctgacc
gactgcctgttcgtccacgtgctcggcgcgtatgtcgagccggagcgcaacggccgctgg
accgcgctgcgcaagctgccgatcgcgcaggccggcttcgacgaggacgacgcgctgatc
gactacccggcgaagtcgcaccccgcgtatcgcctgctcaccgaatacttcgcgttcccc
gacaagttcgatttcgtcgatttcgacctcgcggcgatcgcgcgcgcgtcgggccgctgc
cagcgcgcgacgttgcatctggtgctgcaggacgtgcgcagcgattcgcacgtcgcgcgg
ctgctcgagttgctgacggccagccatttccggctgttctgcacgccgatcgtcaacctg
ttccgccagcacggcgaaccgatccgcatcacgcaccgcgcggtgtcgtacccggtgatc
gccgaagcgcgccgcgcgttcgcgtacgaggtgtactcgatcgattcggtgaagctcgtc
cggcagcaggcgcatgaagaatcggtgatcgagttccggccgttctattcgctgcatcac
ggcgaatcggcacggatcggtcattactggttcgcgcgccgcaacgactgggtcgcgcag
aagagccccggctacgaaaccgagatctcgatcgtcgacatcgacttcgaaccgacgtcg
ccgcagaccgacaccctgagcctcgacctcacctgcacgaaccgcgacctgccggcgatg
ctcgcgttcggcctcgagggcggcgatctgttccaggacggcggagcgcagacgagcggc
atctcgctgctgcggcgcccgacgcaaagcgtgcgcttcgagcgcggccgcgccgcgcac
tggcggcttgtgtcgcatctcgcgctgaaccacgtgtcgctggtcgcgcacgggctcgca
ccgctcaaggaaatgctgacgctgtacgacctgcggcgcaccgccgtgtcgatgcgccag
atcgacggcttggccggcgtcgagcagcgcggcgccgtgcagtggctgcccggcaagccg
ttcgcgaccttcgtgcgcggcatcgagatccggctgacgatcgacgaggaacacttcgtc
ggtgcgagcctcgcgtcgttcgtgcgcgtgctcgacagcttcttcgggctgtacgtccat
ctcaacagtttcgttcaattggtcgtcgtgtcgaagcgcaccggcgaggagatcatccga
tgcaagccccgaaccggcgaatcgatcctggcgtag

DBGET integrated database retrieval system