KEGG   Burkholderia cepacia GG4: GEM_3042Help
Entry
GEM_3042          CDS       T02205                                 

Definition
(GenBank) type vi secretion system protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bct  Burkholderia cepacia GG4
Pathway
bct03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bct00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    GEM_3042
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bct02044]
    GEM_3042
Secretion system [BR:bct02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GEM_3042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AFQ49438
UniProt: J7JDR9
Position
1:complement(3328225..3328728)
Genome map
AA seq 167 aa AA seqDB search
MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMI
FTKEIDSSSPLLYQHASGGTTFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVRE
EGLPLETFSLKYAAVQWKQTQQKIGGNQGGNTQGAWSLTKNDKTYAV
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgttacatatgcacttgcagtttggtagtccggcggtgaagggcgaatccgcggacaaa
gaccatcagggctggatcgaactgaaatcgtgggatcactcgatcgttcagccgcgttcg
gcaacggcatcgaccgcaggcggtcacacgatgacgcgctgcgaacacggcgacatgatt
ttcacgaaggaaatcgattcgtcgagcccgctgctgtaccagcacgcatcgggcggcacc
acgttcgatgaagtgacggtccatttctcgcgcgcggatggcgaaggcaagcgcgtgcag
tatctggaagtgaagctcaagtacgtgatcatctcgagcatcgcaccgagcgttcgcgaa
gaaggtctgccgctcgagacgttctcgctgaagtacgcagccgtgcagtggaagcagacc
caacagaagatcggcggcaaccagggcggcaacacgcagggcgcctggagcctgacgaag
aacgacaagacctacgcggtctaa

DBGET integrated database retrieval system