KEGG   Burkholderia cepacia GG4: GEM_3048Help
Entry
GEM_3048          CDS       T02205                                 

Definition
(GenBank) transmembrane protein
  KO
K11892  type VI secretion system protein ImpK
Organism
bct  Burkholderia cepacia GG4
Pathway
bct03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bct00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    GEM_3048
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bct02044]
    GEM_3048
Secretion system [BR:bct02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GEM_3048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: AFQ49444
UniProt: J7JAQ1
Position
1:3333939..3334721
Genome map
AA seq 260 aa AA seqDB search
MSYAPSLFGDNAPAPLHTPASTDAAFQARSLLDLLYDGFFMLFLLKNGRAPDSASEFSTK
IQEFLSDFERGAKKLNIAAEDVYSAKFAYCAAVDEMVLSSQFKIRADWERRPLQLVLFGE
QLAGEKFFQYLEDCRAQGAARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIA
HMKGKRAPFAPHWPLPDQIAHRLKREVPVWAIGAVFALVALLGYLGLNTYLKDKTLQALA
PYSQVIKVGPESANLTISLP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgcgccttccctgttcggcgacaacgcgccggccccgctgcataccccggcg
tcgaccgacgccgcgttccaggcccgttcgctgctcgacctgctgtacgacgggttcttc
atgctgttcctgctcaagaacggccgcgcgcccgacagcgcgagcgagttcagcacgaag
atccaggaattcctgtcggatttcgagcgcggcgcaaagaagctgaacatcgcggccgag
gatgtctacagcgcgaagttcgcgtattgcgcggccgtcgacgaaatggtgctgtcgtcg
cagttcaagattcgcgccgactgggaacgccggccgctgcagctcgtgctgttcggcgag
cagctcgcgggcgagaagttcttccagtatctcgaggattgccgcgcgcagggcgcggcg
cggctgcagtcgctcgaagtgttccacatgtgcctgctgctcggcttccagggcaagtat
ctgctcgaagggccggagaagctcgcgtatctgaccgcgcggctcggcgatgaaatcgcg
cacatgaagggcaagcgcgcgccgttcgcgccgcactggccgctgccggaccagatcgcg
caccggttgaagcgcgaagtgccggtatgggcgatcggtgccgtgttcgcgctcgtcgcg
ctgctcgggtatctcgggctaaacacgtacctgaaggacaagacgctgcaggcgcttgca
ccgtattcgcaggtgatcaaggtcgggccggagtcggcgaacctgacgatttcgctgcct
tga

DBGET integrated database retrieval system