KEGG   Burkholderia cepacia GG4: GEM_3577Help
Entry
GEM_3577          CDS       T02205                                 

Definition
(GenBank) bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase
  KO
K13522  bifunctional NMN adenylyltransferase/nudix hydrolase [EC:2.7.7.1 3.6.1.-]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00760  Nicotinate and nicotinamide metabolism
bct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bct00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    GEM_3577
Enzymes [BR:bct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     GEM_3577
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     GEM_3577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX CTP_transf_like NUDIX_4 FAD_syn
Motif
Other DBs
NCBI-ProteinID: AFQ49968
UniProt: J7JF73
Position
2:436437..437477
Genome map
AA seq 346 aa AA seqDB search
MSTQQNRRFDALVFIGRFQPPHRGHLNVLKSALSRAERVCVLIGSTDKPRTVKDPFSFDE
RRQMLASLLDASERERVTIAPVQDSTYNDGDWVRWVQDAVAAALGDVAQRKVGLIGHEKD
ATSYYLRMFPQWELVDVDATEDISATEIRDQYFAERTNSFVQWAVPEPVFGWLERFRTQP
EFAQLKAEAEFIAAYRKAWSAAPYPVTFVTVDAVVVHSGHILLVRRRSEPGRGLWALPGG
FVNQDERLDAACIRELREETGLKLPEPVLRGSIKDRQVFDHPTRSLRGRTITHACLFNFP
TGELPRVKGSDDADKARWVPLNEFAQMRNVMFEDHFEIAYHFLGKL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcaacagaaccggcgcttcgacgcgctcgttttcattggtcgtttccagcct
ccgcatcgtggtcacctgaatgtgctgaagtcggcactgagccgcgccgagcgcgtgtgc
gtgctgatcgggtcgaccgacaagccccgcaccgtcaaggatccgttttcgttcgacgag
cgccgccaaatgctggcttcgctgctcgatgcgtccgagcgcgagcgcgtgacgatcgcg
cccgtgcaggattcgacgtacaacgacggcgactgggtgcgctgggtgcaggacgcggta
gccgccgcgctcggcgacgtcgcgcagcgcaaggtcgggctgatcggccacgagaaggac
gccacctcgtattacctgcggatgttcccgcaatgggagctcgtcgacgtcgatgcgacc
gaagacatttccgcaaccgagatccgtgaccagtatttcgccgagcgcaccaacagcttc
gtgcaatgggccgtgccggaacccgtgttcggctggctcgagcgttttcgcacgcagccc
gaattcgcgcagctgaaggccgaggccgaattcatcgccgcgtatcgcaaggcgtggtcg
gctgcgccgtatccggtcacgttcgtgacggtcgacgcggtggtcgtgcactcgggccat
atcctgctcgtgcgccggcgcagcgaaccgggccgcggcctgtgggcgctgcctggcggg
ttcgtgaaccaggacgagcggctcgacgcggcgtgcattcgcgaactgcgcgaggagacc
ggcctgaagctgccggagcccgtgctgcgcggctcgatcaaggatcgccaggtgttcgat
catccgacccgctcgctgcgcggccgcacgatcacgcatgcatgcctgttcaatttcccg
accggcgagctgccgcgcgtgaagggcagcgacgacgccgacaaggcgcgctgggtgccg
ctcaacgaattcgcgcagatgcgcaacgtgatgttcgaggatcacttcgagatcgcgtat
cacttcctggggaagctgtga

DBGET integrated database retrieval system