KEGG   Burkholderia cepacia GG4: GEM_4110Help
Entry
GEM_4110          CDS       T02205                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00362  Benzoate degradation
bct00620  Pyruvate metabolism
bct00621  Dioxin degradation
bct00622  Xylene degradation
bct00650  Butanoate metabolism
bct01100  Metabolic pathways
bct01120  Microbial metabolism in diverse environments
bct01220  Degradation of aromatic compounds
Module
bct_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GEM_4110
   00650 Butanoate metabolism
    GEM_4110
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GEM_4110
   00622 Xylene degradation
    GEM_4110
   00621 Dioxin degradation
    GEM_4110
Enzymes [BR:bct01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     GEM_4110
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     GEM_4110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AFQ50500
UniProt: J7J942
Position
2:complement(1011319..1012218)
Genome map
AA seq 299 aa AA seqDB search
MKKIKCALIGPGNIGTDLLYKLRRSTVLEPVWMVGVDPASDGLARAREFGLKTTDQGVDG
LLPHVAADDIRIAFDATSAYVHRDNSDKLTALGVKMIDLTPAAIGPYCVPPVNLDAHLDS
AQMNVNMVTCGGQATIPMVYAVSRVQPVAYGEIVATVSSRSVGPGTRKNIDEFTRTTSGA
IEAVGGARKGKAIIVINPAEPPLIMRDTIHCLTDGPPDVDAITASVHAMVKEVQRYVPGY
TLKNGPVFDGNRVTVFMEVEGLGDYLPKYAGNLDIMTAAAAATAERFAEQMLAATAATA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcaaatgcgcactgatcgggcccggcaacatcggcaccgacctgctgtac
aagctgcgccgctcgacggtgctcgaaccggtgtggatggtgggcgtcgacccggcttcc
gacggcctcgcgcgggcccgcgaattcggcctgaagaccaccgaccagggcgtcgacggg
ctgctgccgcacgtcgccgccgacgacatccgcatcgcgttcgatgcgacctccgcctac
gtgcaccgcgacaactccgacaagctcaccgcgctcggcgtgaagatgatcgacctgacg
cccgccgcgatcgggccgtactgcgtgccgcccgtcaacctcgatgcgcatctcgacagt
gcgcagatgaacgtgaacatggtgacctgcggcggccaggcgacgatcccgatggtgtac
gccgtgtcgcgcgtgcagccggtcgcgtacggcgagatcgtcgcgaccgtgtcgtcgcgc
tcggttggccccggcacgcgcaagaacatcgacgaattcacgcgcacgacgtccggcgcg
atcgaagcggtgggcggcgcacgcaagggcaaggcgatcatcgtgatcaatccggccgaa
ccgccgctgatcatgcgcgacacgatccactgcctgaccgacggcccgccggacgtcgat
gcgatcacggcgtcggtgcatgcgatggtcaaggaagtgcagcgctacgtgcccggctac
acgctgaagaacggcccggtgttcgacggcaaccgcgtgacggtgttcatggaagtcgag
gggctcggcgactacctgccgaaatacgcgggcaacctcgacatcatgaccgccgccgcg
gccgccacggccgagcgtttcgccgaacagatgctggccgcgacggccgccaccgcttga

DBGET integrated database retrieval system