KEGG   Burkholderia cepacia GG4: GEM_4206
Entry
GEM_4206          CDS       T02205                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
bct  Burkholderia cepacia GG4
Brite
KEGG Orthology (KO) [BR:bct00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bct02044]
    GEM_4206
Secretion system [BR:bct02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GEM_4206
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AFQ50596
UniProt: J7JHS8
Position
2:complement(1129153..1131024)
AA seq 623 aa
MDTRLLDYYNRELAYLRELGGEFAQQFPKVAARLRLHESGPPDPYVERLLEGFSFLTARV
QLKMDAEFPRFTQALLDAVYPGYLAPLPSMAIVRFAPMLNEGSLAQGWRLPAGTALRARP
AASEQTACEFRTAHDLTLWPLELTEATVTGAPSWLPRGVVPARQDVRGALRIRLKARGGA
KLSQLPLERLTFHLAGPERDALHLLELIAAHALGVVCHDPGQAPRWLHTLDADAIVHEGF
DPAQAILPDEGRSFHGYRLLREYFAFPARFLFFSISGLRAALTRATGDECELTVLFDRAD
AALEAAVDARHLALNCTPAVNLFARRGDRIPLQPGAREHHVVVDRSRPLDHEVYAVQRLA
SVQRDDGQSREFRPFHASFARDDGNYGAYYTVRREPRLVSAQARANGTRTGYVGSETYVS
LVDSQCAPYDETMRYLSVDTLCTNRDLVLLQPPGDANTFTLRISAPVERIVAIRGPSRPR
PPIADTQSAWRLIRHLGLARQTMTDLDDDEGAHALRELLGLHADPADAAMRRQIDGVRRV
AFSPVFRRLPALGPLMFGRGVQVDVTVDDHAFSGDSPFLLGAVLEQFFARHVSINAFAEC
VLTSTQRGTLAHWPARIGRRPAI
NT seq 1872 nt   +upstreamnt  +downstreamnt
atggatacgcgcctgctcgactactacaaccgcgaactcgcgtatctgcgcgagctcggc
ggcgaattcgcgcagcagttcccgaaggtcgccgcgcggctgcggctgcacgaatcgggg
ccacccgatccgtacgtcgaacggctgctcgaaggcttcagcttcctcaccgcgcgcgtg
cagctgaagatggatgccgagtttccgcgcttcacgcaggcgctgctcgatgccgtgtat
ccgggctatctcgcgccgttgccgtcgatggcgatcgtgcggttcgcgccgatgctgaac
gagggcagcctcgcacagggctggcggctgccggctggcaccgcgttgcgcgcgcggccg
gccgcgtccgagcagaccgcgtgcgaattccgcaccgcgcacgacctgacgctgtggccg
ctcgaactgaccgaggcgaccgtcaccggtgcgccgtcgtggctgccgcgcggggtcgtg
ccggcgcgccaggacgtgcgcggggcgctgcgcatccggctgaaggcacgcggcggtgcc
aaactctcgcaactgccgctcgagcgcctgacctttcatctcgcgggccccgagcgcgac
gcgctgcacctgctcgaactgatcgccgcgcatgcgctcggcgtcgtgtgccacgatccg
gggcaggcgccgcgctggctgcacacgctcgacgccgacgcaatcgtccacgagggtttc
gatccggcgcaggcgatcctgcccgatgaggggcgcagcttccacggctaccggctactg
cgcgagtatttcgcgtttccggcacgcttcctgttcttcagcatcagcgggctgcgcgcc
gcgctcacgcgcgccaccggcgacgagtgcgagctgaccgtgctgttcgaccgcgccgac
gcggcgctcgaagcggccgtcgatgcgcggcatctggcactgaactgcacgccggccgtg
aacctgttcgcccgccgcggcgaccgcattccgttgcagccgggcgcgcgcgagcatcat
gtcgtcgtcgaccgcagccggccgctcgaccatgaggtctatgccgtgcagcggctcgcg
agcgtgcagcgcgacgacggccagtcgcgcgaattccggccgtttcacgcatcgttcgcg
cgcgacgacggcaactatggtgcgtactacacggtgcggcgcgagccccggctggtgtcc
gcacaggcacgcgcgaacggcacgcgcactggctacgtcggcagcgaaacctacgtgtcg
ctggtcgacagccagtgcgcgccgtacgacgagacgatgcgctacctgtccgtcgacacg
ctgtgtaccaaccgcgatctcgtgctgctgcagccgccgggcgacgcgaacacattcacg
ctgcgcatctcggcgcccgtcgagcgcatcgtcgcgattcgtggcccgtcgcggccgcgt
ccgccgatcgccgatacgcagtcggcctggcggctgatccgccatctcgggctggcccgc
cagacgatgaccgatctcgacgacgacgaaggcgcgcatgcgctgcgcgaactgctcggc
ctgcatgccgatccggccgatgctgcgatgcgccggcagatcgacggcgtgcggcgcgtc
gcattctcgcccgtgttccggcggctgccggcgctcgggccgctgatgttcggacgcggc
gtgcaggtcgacgtgaccgtggacgaccatgcgttctccggcgacagcccgttcctgctc
ggcgcggtgctcgaacagttcttcgcgcgtcacgtctcgatcaacgcgttcgccgaatgc
gtgctgaccagcacgcagcgcggcacgctcgcgcactggccggcgcgtatcggcaggcgg
cccgcgatatga

DBGET integrated database retrieval system