KEGG   Burkholderia cepacia GG4: GEM_4210
Entry
GEM_4210          CDS       T02205                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
bct  Burkholderia cepacia GG4
Brite
KEGG Orthology (KO) [BR:bct00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bct02044]
    GEM_4210
Secretion system [BR:bct02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GEM_4210
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AFQ50600
UniProt: J7J9G0
Position
2:complement(1133658..1134197)
AA seq 179 aa
MTDRTKAAGSGQKFIARNRAPRVQIEYDVETYGAERKVQLPFVMGVIADLAGKRAEPLPD
LPERKFLEIDVDNFDERMKSVAPRVAFQVPNTLTGEGMLSVDVTFEQIDDFSPAAIARNV
DALRRLLDARTELSNLLSYMDGKHGAEQLIERAINDPDLLKMLVREPRADATEPEARDE
NT seq 540 nt   +upstreamnt  +downstreamnt
atgacggacagaaccaaggcggcgggcagcggacagaagttcatcgcgcgcaatcgggcg
ccgcgcgtgcagatcgagtacgacgtcgagacctacggcgccgagcgcaaggtgcagctg
ccgttcgtgatgggcgtcatcgcggacctagcgggcaagcgcgccgagccgctgccggat
ttgcccgagcgcaagttcctcgagatcgacgtcgacaacttcgacgagcggatgaaatcg
gtcgcgccgcgcgtcgcattccaggtgccgaacacgctgacgggcgaagggatgctcagc
gtcgacgtgacgttcgagcagatcgacgatttctcgccggcggcgatcgcgcgcaacgtc
gacgcgctgcgccggctgctggacgcgcgcactgagctgtcgaacctgctgtcctacatg
gacggcaagcatggcgccgaacagctgatcgagcgcgcgatcaacgatcccgacctgctg
aagatgctggtgcgcgaaccgcgcgccgatgcgaccgaaccggaggcccgcgatgaatga

DBGET integrated database retrieval system