KEGG   Burkholderia cepacia GG4: GEM_4215
Entry
GEM_4215          CDS       T02205                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
bct  Burkholderia cepacia GG4
Pathway
bct03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bct00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    GEM_4215
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bct02044]
    GEM_4215
Secretion system [BR:bct02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GEM_4215
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: AFQ50605
UniProt: J7J9G5
Position
2:complement(1142110..1143429)
AA seq 439 aa
MNSSSDSISAGAGGFVPPNPGGMHPAAASGAAGPTATQPRPGRWAASGTNPLVAAANPLL
NLVPQIRSTVHHPNPAWLREHLVVEIRQFEARAQEAGVPSEAIIGARYGLCTALDEAAAL
TPWGGSVWSSHSLLVSFHNETWGGEKFFHLLERLSQQPRQHLDLLELLYFCLALGFEGRY
RVLDNGHAQLDALRRQLAQTIRSVRGEFDPALSPHWRDVVSRDVARRFVVPLWVCVALAL
LIGFGVFVGLRIALAGHSDQLFTSIDALHVPKLQPAQAPPRPAPVPRIAQFLAPQIAAGL
VSVRDDADRSVIVLRGDGLFKSGSTSVIDRYTPVLARVADALNQVPGNVRVTGYTDDTPV
HTARFASNWDLSRERAEAVRSMIAARLGHPERLAAEGRGTLDPVAPNDSPTNRALNRRVE
ITLLPAPGNAAAGATQGAN
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgaattcttcctccgattcgatttctgccggcgccggcggattcgtgccgccgaatccg
ggcggcatgcatccggcggcagcgtccggtgccgccgggccgacagccacgcagccgcgg
cccggtcgctgggccgcgagcggcacgaacccgctcgtcgcggccgcgaacccgctgctc
aacctcgtgccgcagatccgctcgaccgtccatcatccgaatccggcgtggctgcgcgag
catctcgtcgtcgagatccgccagttcgaggcacgcgcgcaggaggccggcgtgccgtcg
gaggcgatcatcggcgcgcgctacggcctgtgcacggcgctcgacgaagcggccgcgctg
accccgtggggcggcagcgtgtggtcgtcgcacagcctgctcgtgtcgttccacaacgaa
acctggggcggcgagaagttcttccacctgctcgagcgcctgtcgcagcaaccgcgccag
catctcgacctgctggagctgctgtatttctgtctcgcgctcgggttcgagggccgttat
cgcgtgctcgacaacggccacgcgcaactcgatgcgctgcgccgccagctcgcgcagaca
atccgctcggtgcgtggcgaattcgatcccgcgctgtcgccgcactggcgcgacgtcgtc
tcgcgcgacgtcgcgcgccgtttcgtcgtgccgctgtgggtctgcgtggcgctcgcgctg
ctgatcggcttcggcgtgttcgtcgggctgcgcatcgcgctcgccgggcattcggaccag
ctgttcacatcgatcgacgcgctgcacgtgccgaaactgcagcccgcgcaggcgccgccg
cgcccggcgccggtgccgcgcatcgcgcagttccttgcgccgcaaatcgccgccggcctg
gtgtcggtgcgcgacgacgccgatcgcagcgtgatcgtgctgcgcggcgacgggctgttc
aagtccggctcgacgtcggtgatcgaccgttacacgccggtgctcgcgcgcgtcgcggat
gcactgaaccaggtgcccggcaacgtgcgcgtgaccggctataccgacgatacgcccgtg
catacggcgcgtttcgcgtcgaactgggacctgtcgcgcgaacgggcggaggccgtgcgc
agcatgatcgccgcgcggctcggtcatccggagcggctcgcggcggaagggcgcggcacg
ctcgacccggtcgcgccgaacgactcgcccacgaaccgcgcgctgaaccggcgtgtcgag
atcacgctgctgccggcacccggcaacgccgcagccggcgcgacgcagggggccaactga

DBGET integrated database retrieval system