KEGG   Burkholderia cepacia GG4: GEM_4216Help
Entry
GEM_4216          CDS       T02205                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
bct  Burkholderia cepacia GG4
Brite
KEGG Orthology (KO) [BR:bct00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bct02044]
    GEM_4216
Secretion system [BR:bct02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GEM_4216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: AFQ50606
UniProt: J7JHT9
Position
2:complement(1143445..1144833)
Genome map
AA seq 462 aa AA seqDB search
MTEPTMSATPVAALRQRVVWTEGMFLRPQHFQQLERHWERYVALRCLPLQGFYWGFDTLE
LDREQLALGKVALRAAAGVMRDGTPFDLSHPDDLPEPLDVPTDAKDQLVVLALPLWRGGG
EEMSFDAGGNGRGNGNVDVARYVVREYEVADANAVALGPALLQTGRLNVRLMLDTQLTGD
WHALGVARIVERRTDARLLVDGGYIPPRLVAQRDAALLAYTRELHGLLTQRSDALAERLS
EPGRGGVSEVADFLLLQLVNRYLALTWHAQQDVATHPEALFRDWLKLACDLSTFTAAGRR
PQSLAVYVHDDLRTSFAELMTELRRSLSTVLEQNAIQIELRDAGNGIRVATLADPALRDT
AGFVLAVRADVPADSLRTRFPAQAKLGPVERIRDLVQLQLPGITMRQLPVAPRQIPYHAG
HTYFEIDKGSDLWKQLARSGGLAFHFAGEFPGLSMEFWAIRG
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaccgacgatgtccgcgacaccggtcgccgcactgcgccagcgcgtggtgtgg
accgaaggaatgttcctgcggccgcagcatttccagcagctcgaacggcactgggaacgc
tacgtcgcgctgcgctgcctgccactgcaagggttctactggggcttcgacacgctcgaa
ctcgaccgcgagcagctcgcgctcggcaaggtcgcgctgcgcgcggcggcgggcgtgatg
cgcgacggcacgccgttcgacctgtcgcatcccgacgatctgcccgagccgctcgacgtg
ccgaccgatgcgaaggaccagctcgtcgtgctcgcgctgccgctgtggcgcggcggcggc
gaggagatgtcgttcgacgcaggcggcaacggtcgcggcaacggcaacgtggacgtcgcg
cgctacgtcgtgcgcgagtacgaagtggccgatgcgaacgcggtcgcgctcggcccggca
ttgctgcagacgggacgcctgaacgtcaggctgatgctcgacacccagctgaccggtgac
tggcatgcgctcggcgtcgcgcggatcgtcgagcggcgcaccgatgcgcggctgctcgtc
gacggcggctatattccgccacgcctggtcgcacagcgcgatgccgcgctgctggcgtac
acgcgcgagctgcacggactgctcacgcagcgcagcgacgcgcttgccgaacgattgtcg
gaaccggggcgcggcggtgtgtcggaagtcgctgacttcctgctgctgcagctcgtgaac
cgctatctggcgctgacctggcatgcgcagcaggacgtcgcgacccatccggaggcgctg
ttccgcgactggctgaagctcgcgtgcgatctcagcacgttcacggcggcgggccggcgc
ccgcagtcgctcgcggtctacgtgcacgacgacctgcgcacgagcttcgccgaactgatg
acggagttgcgccggtcgctgtcgacggtgctggagcaaaacgcgatccagatcgagttg
cgcgacgcgggcaacggcatccgggtcgcgacgctcgccgatcccgcgctgcgcgacacg
gccggcttcgtgctcgcggtgcgcgcggacgtgccggccgacagcctgcgcacgcggttt
cccgcgcaggcgaaactcggcccggtcgagcggatccgtgacctggtgcagctgcagctg
ccgggcatcacgatgcgccagttgccggtcgcgccgcggcagatcccgtatcacgcgggc
catacgtacttcgagatcgacaagggcagtgacctgtggaagcagctggcgcgctccggc
ggtctcgcatttcatttcgcaggcgaattcccggggctctcgatggagttctgggcgata
cgcgggtga

DBGET integrated database retrieval system