KEGG   Burkholderia cepacia GG4: GEM_4219Help
Entry
GEM_4219          CDS       T02205                                 

Definition
(GenBank) FHA domain-containing protein
  KO
K07169  FHA domain-containing protein
Organism
bct  Burkholderia cepacia GG4
Brite
KEGG Orthology (KO) [BR:bct00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    GEM_4219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA Yop-YscD_cpl
Motif
Other DBs
NCBI-ProteinID: AFQ50609
UniProt: J7JE15
Position
2:1146412..1147839
Genome map
AA seq 475 aa AA seqDB search
MQLIVIEHAGEPVGNDSYDAVVFHPPGGTIGRATDNHLVLRDDTRQISRLQALLQVGDDA
CLLKNLSSVSTIEVNREPVGYAQERPLHSGDIIRIGPYVLRAERDDGTGAPVVDMTSDSG
ASADLRCGPAAAARSHGETKGAGNRLWGLLQNRFVPRGKESGVDVRSGPARTAAPQPASR
AATAAPSAPSQRDLNQLSIDPLDLFAQSSSDLGVSGSPSSDERSGAAERAAPSATQADHA
PEWTQHVRVQPAAGRADTRPADEPAPQAARAPAPPTPDELLTAFFEGAGLDTAAASHQWS
AEQLYIAGQLLALFANGTVELLSSRSILKREVKAHMTMLLDRENNPLKLLPDGGAVLRQM
FGLPLPGFMSPQSAVSDAFQDLHAHQIGMVAGMRAALMDLLTRFSPQRLRERDDAMRWYE
KRVPALYKARMWDRYAATHRDTVFAIEDDFASVFGKAFLAAYDAEVESYRGSSRH
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgatcgtgatcgaacatgccggcgagccggtcggaaacgactcctacgacgct
gtcgtgttccacccgcccggcggcaccatcggccgggcgaccgacaatcatctcgtgctg
cgcgacgacacccggcagatttcgcggctgcaggccctgctgcaggttggcgacgacgcg
tgcctgctgaagaacctgagcagcgtgtcgacgatcgaggtgaaccgcgagccggtcggc
tatgcgcaggagcgcccgctccatagcggcgacatcatccgcatcgggccgtacgtgctg
cgggccgaacgtgacgacggaaccggcgcgccggtcgtcgacatgacctccgattccggc
gcaagcgccgacctgcggtgcggcccggcggctgccgcgcggtctcacggcgagacgaaa
ggcgccggcaaccggctgtgggggctgctgcagaatcgcttcgtcccgcgcggcaaggag
tcgggcgtcgacgttcggtcgggcccggcacgcacggcggcgccgcagccggcgagccgc
gctgcgacggccgcgccctccgcgccatcgcagcgcgacctgaatcagctgtcgatcgat
ccgctcgacctgttcgcgcagtcgtcgtccgatctcggcgtatcgggttcgccttcatcc
gacgaacgcagcggcgctgccgagcgcgccgcgccgtccgcgacgcaggccgaccacgcg
cccgagtggacgcagcacgtgcgcgtgcaaccggcggccgggcgcgccgatacccggccg
gccgacgagccggcgccgcaggcggcccgcgcgccggcaccgccgacccctgatgaatta
ctgaccgcgttcttcgaaggcgcggggctcgatacggccgccgcatcgcatcagtggtcg
gccgaacagctatacatcgccgggcaattgctggcgctgttcgcgaacggcacggtcgag
ctgctgtcgtcgcgcagcatcctgaagcgggaggtgaaggcgcacatgacgatgctgctc
gatcgcgagaacaacccgctgaagctgctgccggacggtggcgccgtgctgcgccagatg
ttcggactgccgctgccaggcttcatgtcgccgcagagcgcggtcagcgacgcgttccag
gatctgcacgcgcaccagatcggcatggtcgccggcatgcgcgccgcgctgatggacctg
ctgacgcgcttttcgccgcaacggctgcgcgagcgcgacgatgcgatgcgctggtacgag
aagcgcgtgcccgcgctctacaaggcgaggatgtgggatcgttatgccgcgacccatcgc
gacacggtgttcgcgatcgaagacgatttcgcgtcggtgttcggcaaggcatttcttgcg
gcgtacgacgcggaagtggaaagctatcgcggcagcagccggcattga

DBGET integrated database retrieval system