KEGG   Burkholderia cepacia GG4: GEM_5031Help
Entry
GEM_5031          CDS       T02205                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bct00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GEM_5031
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bct02000]
    GEM_5031
Enzymes [BR:bct01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     GEM_5031
Transporters [BR:bct02000]
 Other Transporters
  Pores ion channels [TC:1]
   GEM_5031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N GST_C_3 GST_C FbpA
Motif
Other DBs
NCBI-ProteinID: AFQ51418
UniProt: J7JJ38
Position
2:complement(2065658..2066320)
Genome map
AA seq 220 aa AA seqDB search
MESTGPTTLTISSRNYSSWSMRGWLLAKLSGLAFETVSVPIDAASRAELLLLSPSILVPC
LTHEGSTVWDTLAIAEYLNEVQPQARLLPDDRHARAHCRSICGEMHSGFSALRSALPMNL
RAHFPGFRIWSRAQHDIERIVTIWRECLAAYGGPWLFGEQIGIADAMYAPVVTRFLTYDV
KLEPDIAEYCMRMLAHPFVAEWIDAAKAEHEDIDELDMEF
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggaatctaccggaccgaccacgttgaccatcagcagccgcaattactcgtcgtggtcg
atgcgcggctggctgctcgcgaagctgagcggcctcgcgttcgagacggtcagcgtgccg
atcgatgcggcatcgcgcgcggagctgctgctgctgtcgccgtcgattctcgtgccgtgc
ctgacgcacgaaggcagcacggtgtgggacacgctcgcgatcgccgaatacctgaacgaa
gtccagccgcaggcgcggctgctgcccgacgaccggcatgcgcgcgcgcattgccggtcg
atctgcggcgagatgcattcgggtttcagcgcgctgcgctccgcgctgccgatgaacctc
cgtgcgcattttcccggcttccggatctggtctcgtgcgcagcacgacatcgaacgcatc
gtgacgatctggcgcgagtgtctggccgcgtacggcggcccctggctgttcggcgagcag
atcggcatcgccgatgcgatgtacgcgccggtcgtcacgcgattcctgacctacgacgtg
aaactcgagcccgatatcgccgagtactgcatgcgcatgctcgcgcatccgttcgttgcg
gagtggatcgatgccgcgaaagcggagcacgaagacatcgacgaactcgacatggagttc
tga

DBGET integrated database retrieval system