KEGG   Burkholderia cepacia GG4: GEM_5708Help
Entry
GEM_5708          CDS       T02205                                 

Definition
(GenBank) 2-methylisocitrate dehydratase, Fe/S-dependent
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00640  Propanoate metabolism
bct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    GEM_5708
Enzymes [BR:bct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     GEM_5708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AFQ52092
UniProt: J7JCU4
Position
2:2784990..2787584
Genome map
AA seq 864 aa AA seqDB search
MNTANRKPLPGTSLDYFDARAAVEAIAPGAYDTLPYTSRVLAENLVRRADPAILADSLKQ
IIERKRERDFPWFPARVVCHDILGQTALVDLAGLRDAIAERGGDPAKVNPVVPVQLIVDH
SLAVECGGFDPDAFAKNRAIEDRRNEDRFHFIEWTKQSFENVDVIPPGNGIMHQINLEKM
SPVIQAQDGVAYPDTCVGTDSHTPHVDALGVIAIGVGGLEAENVMLGRASWMRLPDIVGV
ELTGKRQPGITATDVVLALTEFLRKEKVVGAYLEFRGAGAASLTLGDRATISNMAPEYGA
TAAMFFIDGQTTDYLRLTGRSDEQVKLVETYAKAAGLWADTLNNAQYERTLTFDLSSVVR
NMAGPSNPHKRLPTSDLAARGIAGAWEEKAGEMPDGAVIIAAITSCTNTSNPRNVIAAAL
LARNANAKGLTRKPWVKSSLAPGSKAVELYLEEANLLPELEKLGFGIVAFACTTCNGMSG
ALDPKIQQEIVDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIE
KDVLGHDPDGKPVTLKDIWPTDEEIDAIVASSVKPEQFRKVYEPMFARTADAGERAAPLY
DWRAQSTYIRRPPYWEGALAGERTLKGMRPLAVLGDNITTDHLSPSNAILANSAAGEYLA
KMGLPEEDFNSYATHRGDHLTAQRATFANPTLINEMAVVDGAVKKGSLARVEPEGQVMRM
WEAIETYMNRKQPLIVIAGADYGQGSSRDWAAKGVRLAGVEVIVAEGFERIHRTNLIGMG
VLPLEFKPGTNRTTLGIDGTETFDVIGERTPRADLTLVIHRKNGERVEVPVTCRLDTAEE
VSIYDAGGVLQRFAQDFLESSQAA
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgaataccgccaaccgcaaacccctgcccggcacgtcgctggactacttcgacgcgcgt
gccgcggtcgaagcgatcgcacccggcgcgtacgacacgctgccgtacacgtcgcgcgtg
ctcgccgaaaacctcgtgcgccgcgccgatccggcgatcctcgccgattcgctgaagcag
atcatcgagcgcaagcgcgagcgcgacttcccgtggttcccggcgcgcgtggtgtgccac
gacatcctcggccagacggcgctcgtcgacctcgcgggcctgcgcgacgcgatcgcggag
cgcggcggcgacccggcgaaggtgaacccggtcgtgcccgtgcagctgatcgtcgaccac
tcgctcgccgtcgagtgcggcggcttcgatccggacgcgttcgcgaagaaccgcgcgatc
gaggatcgtcgcaacgaggatcgcttccacttcatcgaatggaccaagcagtcgttcgag
aacgtcgacgtgatcccgccgggcaacggcatcatgcaccagatcaacctggagaagatg
tcgccggtgatccaggcacaggacggcgtcgcgtatccggacacctgcgtcggcaccgac
agccacacgccgcacgtcgacgcgctcggcgtgatcgcgatcggcgtcggcggcctggag
gcggagaacgtgatgctcggccgcgcatcgtggatgcgcctgcccgacatcgtcggcgtc
gagctgaccggcaagcgccagcccggcatcaccgcgaccgacgtcgtgctcgcgctgacc
gagttcctgcgcaaggaaaaggtggtcggcgcatatctggaattccgcggtgcgggcgcg
gcgagcctcacgctcggcgaccgcgcgacgatctcgaacatggcgcccgaatatggcgcg
acggccgcgatgttcttcatcgatggccagacgaccgactacctgcgcctcaccggccgc
agcgacgaacaggtgaagctggtcgagacctatgcgaaggcggcgggcctgtgggccgat
acgctgaacaatgcgcagtacgagcgcacgctgacgttcgacctgtcgagcgtggtgcgc
aacatggccggcccgtcgaacccgcacaagcggctgccgacgtccgacctcgccgcgcgc
gggatcgccggcgcgtgggaagagaaggcgggcgagatgcccgacggtgcggtgatcatc
gccgcgatcacgagctgcacgaacaccagcaacccgcgcaatgtgattgcagccgccttg
ctcgcgcgcaacgcgaacgcgaagggcctcacgcgcaagccgtgggtgaagagctcgctc
gcgccgggatcgaaggcggtcgagctgtatctggaagaagcgaacctgctgccggaactc
gagaagctcggcttcggcatcgtcgcgttcgcgtgcacgacctgcaacgggatgtcgggc
gcgctcgatccgaagatccagcaggagatcgtcgaccgcgacctgtacgcgacggccgtg
ctgtccggcaaccgcaacttcgacggccgcatccatccgtatgcaaagcaggcgttcctc
gcgtcgccgccgctcgtcgtcgcgtatgcgatcgccggcacgatccgcttcgacatcgag
aaggacgtgctcggtcacgacccggacggcaagcccgtcacgctgaaggacatctggccg
accgacgaggagatcgatgcgatcgtcgcgtcgagcgtgaagcccgagcagttccgcaag
gtctacgagccgatgttcgcgcgcacggccgatgccggcgagcgcgcggcgccgctgtac
gactggcgcgcgcagagcacctacatccgccgtccgccgtactgggaaggcgcgctggcc
ggcgaacgcacgctcaagggcatgcgcccgctcgcggtgctcggcgacaacatcacgacc
gaccacctgtcgccgtcgaacgcgatcctcgcgaacagcgcggccggtgagtacctggcc
aagatgggcctgccggaagaagacttcaactcgtacgcgacgcaccggggagaccacctg
accgcgcagcgcgcgaccttcgcgaacccgacgctgatcaacgagatggcggtggtcgac
ggcgcggtgaagaagggctcgctcgcgcgcgtcgagccggaaggccaggtcatgcggatg
tgggaagcgatcgagacctacatgaatcgcaagcagccgctgatcgtgatcgccggcgcc
gactacggccagggctcgtcgcgcgactgggccgcgaagggcgtgcggctcgcgggcgtc
gaggtgatcgtcgccgaagggttcgagcggatccaccgcacgaacctgatcgggatgggc
gtgctgccgctcgagttcaagccgggcacgaaccgcaccacgctcggcatcgacggcacc
gagaccttcgacgtgatcggcgagcgcacgccgcgcgccgatctcacgctggtgattcac
cgcaagaacggcgaacgcgtcgaggtaccggtgacgtgccggctcgatacggccgaggaa
gtgtcgatctacgacgcgggcggcgtgctgcagcgtttcgcgcaggacttcctcgaatcg
tcgcaggcggcatga

DBGET integrated database retrieval system