KEGG   Burkholderia cepacia GG4: GEM_5850Help
Entry
GEM_5850          CDS       T02205                                 

Definition
(GenBank) selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00450  Selenocompound metabolism
bct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bct00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    GEM_5850
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bct03016]
    GEM_5850
Enzymes [BR:bct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     GEM_5850
Transfer RNA biogenesis [BR:bct03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    GEM_5850
 Prokaryotic Type
    GEM_5850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AFQ52234
UniProt: J7JIC0
Position
2:2943738..2944802
Genome map
AA seq 354 aa AA seqDB search
MTEATLTPPAVPRLTSLSHGGGCGCKIAPGVLSELLKRATPPALFPDLLVGTETSDDAAV
YRLNDEQAIVATTDFFMPIVDDPFDFGRIAATNALSDVYAMGGKPILALALVGMPINVLP
HETIAAVLRGGESVCAEAGIPVAGGHSIDSVEPIYGLAAIGVVHPSRVKRNAAARAGDVL
VLGKPLGVGVLSAALKKNQLDDAGYAQMVATTTKLNRPGAELAALPGVHALTDVTGFGLL
GHTLELARGANLTARVHYASLPWLAGVEAFVADGVFTGASGRNWAAYGTDVRLADGLPLV
AQALLTDPQTSGGLLVACAPEAVDDVLACFRADGFDRAAVIGEMADGPARVDVA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccaccctcaccccgcccgccgttccgcgcctcacgagcctgtcgcacggg
ggcggctgcggctgcaagatcgcgccgggcgtgctgtccgagctgctgaagcgcgcgacg
ccgccggcgctgttccctgatctgctggtcggcaccgagacctccgacgacgcggccgtc
taccggctgaacgacgagcaggcgatcgtcgcgaccaccgacttcttcatgccgatcgtc
gacgatccgttcgacttcggccgcatcgcggcgaccaacgcgctgtcggacgtttacgcg
atgggcggcaagccgattctcgcgctcgcgctggtggggatgccgatcaacgtgctgccg
cacgagacgatcgcggccgtgctgcgcggcggcgaatcggtgtgcgcggaggccggcatt
ccggtcgcgggcggccattcgatcgattcggtcgagccgatctacgggctcgcggcgatc
ggcgtcgtgcatccgtcgcgcgtgaagcgcaatgcggccgcgcgcgcgggcgacgtgctg
gtgctcggcaagccgctcggcgtcggcgtgctgtcggccgcgctgaagaagaaccagctc
gacgacgcgggctacgcgcagatggtcgcgacgaccaccaagctgaaccggccgggcgcc
gagctcgccgcgctgccgggcgtgcatgcactgaccgacgttacgggcttcgggctgctc
ggccacacgctcgagctcgcacgcggcgcgaacctcaccgcacgcgtgcactacgcgtcg
ctgccgtggctggcgggcgtcgaggcgttcgtcgccgacggcgtgttcaccggcgcatcg
ggtcgcaactgggccgcgtacggcaccgacgtgcggctcgccgacgggctgccgctggtc
gcgcaggcgctgctgaccgatccgcagacgtccggcggcctgctggtcgcgtgcgcgccg
gaggcggtcgacgacgtgctcgcgtgcttccgtgccgacggtttcgaccgcgcggcggtg
atcggcgagatggcggacgggcccgcgcgcgtcgacgtcgcctga

DBGET integrated database retrieval system