KEGG   Bacillus cereus AH820: BCAH820_0490
Entry
BCAH820_0490      CDS       T00814                                 

Symbol
pfl
Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
bcu  Bacillus cereus AH820
Pathway
bcu00620  Pyruvate metabolism
bcu00640  Propanoate metabolism
bcu00650  Butanoate metabolism
bcu01100  Metabolic pathways
bcu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCAH820_0490 (pfl)
   00640 Propanoate metabolism
    BCAH820_0490 (pfl)
   00650 Butanoate metabolism
    BCAH820_0490 (pfl)
Enzymes [BR:bcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     BCAH820_0490 (pfl)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ACK89250
UniProt: B7JNE2
Position
479752..482001
AA seq 749 aa
MTQVLENVKNAWENFKGEKWKAEIDVRDFILNNVNVYEGDESFLAGATEATKQLWDQVMD
LTTKERENGGVLDMDTKIVSSITSHEPGYLNKETEKVVGFQTDKPFKRSLQPYGGIRMAE
QACESYGYEMDKELSRIFRDWRKTHNQGVFDAYTPEMRAARKSGVITGLPDAYGRGRIIG
DYRRVALYGVDHLIEAKKADLNLTGGVMSEDTMRLREELSEQIRALQELKQMAASHGFDI
SKPATNAQEAFQWLYFAYLAAIKEQNGAAMSLGRTSTFLDIYIERDLANGTLTEEDVQEI
VDHFIMKLRLVKFARTPDYNELFSGDPTWVTESIGGMALDGRPLVTKNSFRFLHTLDNLG
PAPEPNLTVLWSKQLPQNFKNYCAKMSIKTSAIQYENDDIMRADYGDDYGIACCVSAMRI
GKQMQFFGARANLAKALLYAINGGKDEKSKAQVGPEYAPITSEVLDYEEVMHKFDMTMEW
LAGLYLNTLNVIHYMHDKYSYERIEMALHDTNVLRTMATGIAGLSVVADSLSAIKYAKVK
PIRDENGIAVDFEIEGDFPKYGNNDDRVDEIAVNLVKTFMNKLRKHKTYRNSVHTMSILT
ITSNVVYGKKTGNTPDGRRTGEPFAPGANPMHGRDTKGALASLLSVAKLPYEDAQDGISN
TFSIIPKALGKEDEVQVRNLVSMLDGYAVKEGHHLNINVFNRETLMDAMEHPEKYPQLTI
RVSGYAVNFIKLTREQQIDVINRTMHESM
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgactcaagtattagaaaatgttaaaaacgcatgggaaaactttaaaggtgaaaaatgg
aaagcagagattgatgttcgcgatttcattttaaataatgtaaacgtttacgagggagat
gaatctttcttagcgggagcaactgaagcaacgaaacaactttgggatcaagtaatggat
ttaacaacgaaagaacgtgaaaacggtggcgttcttgatatggatacaaaaattgtttct
tctattacatcacatgaaccaggatatttaaataaagagactgaaaaagtagtcggtttc
caaactgataaaccatttaaacgttctttacagccatatggtggtattcgtatggcggaa
caagcttgtgaatcttatggatacgaaatggataaagaacttagtcgtatttttagagat
tggagaaaaactcataaccaaggtgtatttgatgcttatacaccagaaatgagagctgct
cgtaaatcaggtgttattactggtcttccagatgcatacggacgtggacgtattatcggt
gactaccgccgcgtagcattatatggagtagatcatttaattgaagcgaagaaagcagat
ttaaatttaactggcggtgtaatgagtgaagatacaatgcgtttacgcgaagaattatct
gagcaaatacgtgcccttcaagagttaaaacaaatggctgcttctcatggatttgatatt
tctaagccagcaacaaatgctcaagaagcattccaatggttatactttgcatatcttgca
gcaattaaagagcaaaacggagctgcaatgagtcttggacgtacttctacattcttagat
atttatattgaaagagatttagcaaatggtactttaacagaagaagacgtacaagaaatt
gtggatcacttcattatgaaattacgtcttgtgaaatttgccagaacacctgattataat
gagttattctctggtgacccaacttgggtaactgagtctatcggtggtatggcattagat
ggtcgtccattagtaacaaagaactcattccgtttcttgcatacattagataatttagga
ccagctccagaaccaaacttaacagttctttggtctaaacaattaccacagaactttaaa
aactactgtgcgaaaatgtctattaaaacatcagcaattcaatatgaaaatgatgacatt
atgcgtgctgactacggcgatgactacggaattgcttgttgtgtatctgcaatgagaatc
ggtaaacaaatgcaattctttggcgcacgtgcaaacttagcaaaagcattgctatatgcg
attaacggtggtaaagatgaaaaatctaaagcgcaagttggtcctgagtatgcaccgatt
acttctgaagtattagattatgaagaagttatgcataagtttgatatgacaatggaatgg
ttagcgggtctatatttaaacacattaaatgttattcactacatgcacgataaatatagc
tacgaacgtattgaaatggcacttcatgatacaaatgttcttcgtacaatggcaacaggt
atcgcgggtctatctgtagtagcagattctttaagtgcaattaaatatgcaaaagtaaaa
ccaattcgcgatgaaaacggaatcgcagttgactttgaaattgaaggagatttccctaaa
tacggtaacaatgatgaccgtgtagatgaaattgctgtaaatcttgtgaaaacatttatg
aataaacttcgtaaacataaaacatacagaaattctgttcatacaatgtcaatcttaaca
atcacatctaacgttgtatacggtaagaaaactggtaacactccagatggtcgccgtact
ggagaaccatttgcaccaggtgcgaacccaatgcatggacgtgatacaaaaggtgcgcta
gcttcattattatctgtagctaaattaccatatgaagatgcacaagatggtatttctaat
acattctctattattccaaaagcacttggtaaagaggatgaagtacaagtacgtaactta
gtatcaatgcttgatggttatgcagtaaaagaaggacatcacttaaatattaacgtattt
aaccgtgaaacattaatggatgcaatggaacatcctgagaaatatccacaattaacaatt
cgcgtatctggttacgctgtaaactttattaaattaactcgtgaacaacaaatcgatgta
attaaccgtacaatgcatgaaagcatgtaa

DBGET integrated database retrieval system