KEGG   Bacillus cereus AH820: BCAH820_0019Help
Entry
BCAH820_0019      CDS       T00814                                 

Definition
(GenBank) deoxynucleoside kinase family protein
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bcu  Bacillus cereus AH820
Pathway
bcu00230  Purine metabolism
bcu00240  Pyrimidine metabolism
bcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BCAH820_0019
   00240 Pyrimidine metabolism
    BCAH820_0019
Enzymes [BR:bcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BCAH820_0019
    2.7.1.76  2'-deoxyadenosine kinase
     BCAH820_0019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Cytidylate_kin2 AAA_33 TsaE Thymidylate_kin AAA_28 AAA_29 CbiA PRK RNA_helicase AAA_25 RsgA_GTPase ParA AAA_16 ABC_tran IstB_IS21 AAA MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ACK87858
UniProt: B7JJD0
Position
complement(22460..23128)
Genome map
AA seq 222 aa AA seqDB search
MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTR
WSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKG
LFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINN
FNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaggcaaaaatatgatataccaaatgacgcagtaatcactatcgctggaaca
gtaggtgtcggtaaatccactatgacaactgcattagctaacgctttaggatatcgcaca
tcatttgaaaaggtagattctaacccgtatttggacaagttctatgctgatttcacacgc
tggagctttcacttacaagtgtactttttagcagaacgatttaaagaacaaaaaaggatt
tttgaatacggtggtggttttgttcaagatcgctctatctatgaagacactggcattttt
gcaaaaatgcatcacgaaaagggtacaatgacggaaactgattatgaaacatacaaaggt
ttatttgacgctatggtcatgactccttacttccctcatccagatttactaatctactta
gaaggttctttcgatgatatcgttgatcgtatccaagaacgtggacgtccgatggaacag
caaacgccaattgagtattggaaagagatgcatgggcgttatgaaaactggattaataac
tttaattcatgccctgtcttacgattaaatattaatgaatacgatattttaaaagatggc
gattccattgaaccaatcattaaaaagatcggccattttttaaaacaaacacgtaaactt
gtaaaataa

DBGET integrated database retrieval system