KEGG   Bacillus cereus AH820: BCAH820_0380Help
Entry
BCAH820_0380      CDS       T00814                                 

Definition
(GenBank) aldolase, class II
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bcu  Bacillus cereus AH820
Pathway
bcu00051  Fructose and mannose metabolism
bcu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BCAH820_0380
Enzymes [BR:bcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BCAH820_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ACK91020
UniProt: B7JMD9
Position
369834..370475
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLDYYETKPEDVVIL
NLDGEVVEGERKPSSELDMHLIYYRNREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGANHIKMAFTVAEEIEFCA
QIYYQTKSIGEPKLLPEDEMENLAKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagagagagaagagattgtagcgtacggaaagaaaatgatttctagc
ggtttaacaaaggggacaggcggtaatattagtattttcaatcgtgagcaaggtcttgtt
gccattagcccaagtggtttagattattatgaaacaaagcctgaagatgtagttatatta
aacttagatggtgaagtagtagagggagagagaaaaccatcaagcgaactcgatatgcac
cttatttattatagaaatcgtgaagatataaatgcgcttgtgcatacacattctccttat
gcgaagacgattgcatcattaggatgggaactgcccgcagtatcatatttaattgctttc
gcaggcccgaatgttcgctgtgcaccgtatgaaacatttggtacgaagcaattagcagag
gctgctttcgaaggaatgatcgatcgtcgtgctgttttacttgcgaaccacggtttaatt
gcgggtgcaaatcatatcaaaatggcatttaccgttgcagaagaaattgagttttgtgcg
caaatttattatcaaacgaaaagcattggggaaccgaagctattgccagaagacgagatg
gagaatttggcgaagaagtttgaagggtatgggcagcagtag

DBGET integrated database retrieval system