KEGG   Bacillus cereus AH820: BCAH820_1415Help
Entry
BCAH820_1415      CDS       T00814                                 

Definition
(GenBank) aminotransferase, class V
  KO
K03430  2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]
Organism
bcu  Bacillus cereus AH820
Pathway
bcu00440  Phosphonate and phosphinate metabolism
bcu01100  Metabolic pathways
bcu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BCAH820_1415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcu01007]
    BCAH820_1415
Enzymes [BR:bcu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.37  2-aminoethylphosphonate---pyruvate transaminase
     BCAH820_1415
Amino acid related enzymes [BR:bcu01007]
 Aminotransferase (transaminase)
  Class V
   BCAH820_1415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACK92164
UniProt: B7JFQ9
Position
1349220..1350317
Genome map
AA seq 365 aa AA seqDB search
MTENHYLLLTPGPLTTTKTVKEVMLYDWCTWDVEYNTMVQKVRAKLVSLATKEEEKYTTV
LMQGSGTFSVEAVIGSVIPKNGKLLVCTNGAYGKRIVQMAEMLHIDVVVSQTEEWEPTNI
VEVEKILQQDKEITHIAVVHCETTTGIINPIVDVCKLGKQYGKVTLVDAMSSFGGIEIDI
AELQIDFLISSANKCIQGVPGFGFVIAQRDELLKCKGQARSLSLDLYDQWETMENQNGKW
RFTSPTHVVHAFYQALLELEKEGGVRARYNRYYNNQKLLVNRMGEIGFKPLVNEKYQSPI
ITSFIYPEGNFEFQQLYNELKRYGFVIYPGKISKVDTFRIGNIGDVHEEDINRLVDSIAK
GVVIG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaatcattacttattattaacgccaggaccattaacgacaacaaagacggta
aaagaagttatgttatacgattggtgtacgtgggatgttgaatataacacgatggtacaa
aaagtaagagctaaacttgtatcgttagcaacgaaggaagaagagaaatatacaacagta
ttaatgcaaggaagcggtacgttttcagtggaagcagtaatcggttctgtcattccaaaa
aacggaaagcttcttgtttgtacaaatggtgcatacggtaaacgaattgtacaaatggca
gagatgttacatatagatgtggtggtcagtcaaacagaagagtgggagcctactaatatt
gtagaggtagaaaagatattacaacaagataaagagattacacatattgcagttgttcat
tgtgaaacaacaacaggtattatcaatccaattgtagacgtatgtaaattaggtaagcaa
tacggaaaagtaacactagttgatgcaatgagtagttttggtggtattgaaatagatatt
gctgagttgcaaattgactttctaattagtagtgcgaataaatgtattcaaggagttcca
gggttcggatttgttattgcacagcgtgatgaattattgaaatgtaaagggcaggcacgt
tcattatctttagatttatacgatcagtgggaaacgatggaaaatcaaaatgggaaatgg
cgttttacgtcacctacacatgttgtacacgctttttatcaagcattacttgaattagaa
aaagaaggcggagtaagagcacgttacaatcgatattacaacaatcaaaaactattagtg
aatagaatgggggaaattggttttaagccactcgtaaatgaaaaatatcaatctcctatt
attacatcttttatttatccggaagggaacttcgaatttcaacagttatataatgagtta
aaacgctacggatttgttatttatcctgggaaaatttcgaaagtagatacgttccgcatt
ggaaatattggtgatgtacatgaggaagacataaatcgtttagtagatagtattgctaaa
ggggttgttataggttga

DBGET integrated database retrieval system