KEGG   Bacillus cereus AH820: BCAH820_1468Help
Entry
BCAH820_1468      CDS       T00814                                 

Definition
(GenBank) aminoglycoside phophotransferase family protein
  KO
K17910  aminoglycoside 2''-phosphotransferase [EC:2.7.1.190]
Organism
bcu  Bacillus cereus AH820
Brite
KEGG Orthology (KO) [BR:bcu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bcu01504]
    BCAH820_1468
Enzymes [BR:bcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.190  aminoglycoside 2''-phosphotransferase
     BCAH820_1468
Antimicrobial resistance genes [BR:bcu01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Phosphotransferases
    BCAH820_1468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Pkinase
Motif
Other DBs
NCBI-ProteinID: ACK91450
UniProt: B7JFW2
Position
complement(1392050..1392952)
Genome map
AA seq 300 aa AA seqDB search
MDSYKQYIKEALPNLSIHSYKQNEEGWDNVAVIVNDELLFRFPRKQEYAMRIPLEKELCT
ILTQSLQEIEVPQYHLIYKNESDEVPLCSYYTLIHGEPLKTEIVANLDEKERKIIITQLA
TFLAALHSIPLKSVTALGFPTEKTLTYWKELQTKLNEYVTNSLTSFQKSTLNRLFENFFA
CIATSAFPNAIIHADFTHHHILFDKQNKIISGIIDFGDAQIGDPAFDFAGLYYDFGHEFT
TSVYEQYSTLTSHHDPLLIHRITSFYQYSPLLHNMIYNFETKNELEFLASIEQLKVILQG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggactcttacaaacaatatataaaagaagctttgcctaatctttctatacactcatat
aaacaaaatgaagaaggatgggataatgtagcggttattgtaaatgatgaactattgttt
cgtttcccgcgaaaacaggaatatgcaatgcgaattccgttagaaaaagaactgtgcaca
attctcactcaatcactacaagaaatcgaagttccacaatatcacctaatttataaaaat
gaatctgatgaagttcctctttgtagttactatactctcattcatggtgaaccattaaaa
acagaaatagttgcgaacttagatgaaaaagaacgaaaaataattattacacaattagct
actttccttgcggctctacatagcattcctctaaaaagtgttacagcgttagggttccct
accgaaaaaacacttacctactggaaagagctacaaactaaattaaatgagtatgttact
aacagtctaacttcgttccagaaatcaaccttaaaccgtttattcgagaatttttttgcc
tgtatagctacatcggcatttccaaatgcaatcattcacgctgactttacacatcatcat
attttatttgataaacaaaataaaatcatttcagggattatcgattttggtgatgctcaa
attggagatcctgcctttgattttgctgggctatattatgatttcggacatgaatttact
acatcagtatatgaacaatatagtacacttacttcacaccatgacccattactcattcac
cgcatcacgagtttttatcagtacagtcctttactacataacatgatttataactttgaa
acaaagaatgaacttgaatttctagcaagtatagaacaactgaaagtaatactgcaggga
tga

DBGET integrated database retrieval system