KEGG   Bacillus cereus AH820: BCAH820_1497Help
Entry
BCAH820_1497      CDS       T00814                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bcu  Bacillus cereus AH820
Pathway
bcu00340  Histidine metabolism
bcu01100  Metabolic pathways
bcu01110  Biosynthesis of secondary metabolites
bcu01230  Biosynthesis of amino acids
Module
bcu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BCAH820_1497 (hisD)
Enzymes [BR:bcu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BCAH820_1497 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACK91240
UniProt: B7JFZ1
Position
1416061..1417350
Genome map
AA seq 429 aa AA seqDB search
MEIVCEDFQKALTKIKLLRENANIIEETVQRSVREIVQNVRESRDEALFFYTKKFDGVEI
KDVRVSEEEIKQASMFVESSFLEALQEAKKNIISYHEKQKRQSMFDCTSKGIIRGQIIRP
LENIGVYVPGGTASYPSSVLMNVLPAKLAGVKKIVMVTPPRAGGIDPHILVAASLAGVDE
IYMIGGAQAIAALAYGTESIPKVDKIVGPGNLYVALAKREVYGIVNIDMIAGPSEIVVIA
DETGNAKYIAADLLSQAEHDERATAICITTNIELAKEVEKEIERQLETLPRSEIARESIN
RNGAIFIVPSIDEALQLSNEIAPEHLELHIKEPMNALAYVKHAGSIFLGPYAPEPLGDYL
AGPNHVLPTSGTARFFSPLSVDDFVKKSSFLSYTEEALRDVKHHIVELANKEGLHAHARA
IQIRFGEEE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggagatagtttgtgaggattttcaaaaggcgttaacgaaaataaaactgttacgagaa
aacgctaatataatagaagaaactgttcaaagaagtgtcagggaaatcgttcagaatgta
agagagagtagagatgaggcgttatttttctatacaaaaaagtttgatggtgtagagatt
aaagatgttcgtgtaagtgaagaagaaataaaacaagcgagtatgtttgtagagagttca
tttttagaagcgttacaagaggcgaagaaaaatattatttcgtaccatgaaaagcaaaaa
agacaatcgatgtttgattgcacgagtaaaggcatcataaggggacaaatcattcggccg
ttagaaaatataggggtatatgtgccaggcggaactgcttcgtatccttcgtcagtatta
atgaatgtattgccagcaaagcttgcgggtgtgaaaaagattgtaatggtaacaccgcca
agagcaggaggaattgatccgcatattttagttgctgcaagccttgcaggagtagatgaa
atttatatgataggtggcgcgcaagcaattgctgctttagcatacgggacggaatcgatt
ccaaaagtagataaaatagttggaccaggaaatttgtacgtcgctctagcgaaacgagaa
gtatacggaatagtaaatatcgatatgattgctggaccgtcagaaatagtagttattgct
gatgaaactggcaatgcaaaatatattgctgctgatttattatcacaagcagaacatgat
gagagagcgacagcaatttgtattacaacgaatatagaattagcaaaagaagtagaaaaa
gagatagaaaggcagttagaaacattaccaagaagtgaaattgcacgtgaatcaataaat
agaaatggagccatttttatcgttccttctatagatgaggcactacagttatcgaatgaa
atcgccccagaacatttagagttacatataaaagaaccgatgaatgctctagcttatgtg
aaacatgcaggatctatctttcttggaccgtatgcaccagaaccgctcggtgattattta
gcgggaccgaatcatgtattaccgacaagtggaacggcaaggtttttctcgccgttatca
gtcgatgatttcgtgaaaaaatcaagttttctatcttatacggaggaagcattaagagat
gtaaaacatcatattgtagaacttgccaataaagaagggctacatgcgcatgcgagagca
attcaaataagatttggggaggaagaataa

DBGET integrated database retrieval system