KEGG   Bacillus cereus AH820: BCAH820_2003Help
Entry
BCAH820_2003      CDS       T00814                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bcu  Bacillus cereus AH820
Pathway
bcu00260  Glycine, serine and threonine metabolism
bcu00750  Vitamin B6 metabolism
bcu01100  Metabolic pathways
bcu01110  Biosynthesis of secondary metabolites
bcu01120  Microbial metabolism in diverse environments
bcu01230  Biosynthesis of amino acids
Module
bcu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCAH820_2003 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BCAH820_2003 (thrC)
Enzymes [BR:bcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BCAH820_2003 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: ACK90180
UniProt: B7JKG1
Position
1908782..1909840
Genome map
AA seq 352 aa AA seqDB search
MYKGLLNQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQRAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIDEPETIATAIRI
GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQS
GKIKKGETVVAVLTGNGLKDPDIAISSNTLDIASVSNNIEQIKEHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagggctattaaaccaatatgcttcttatttaccggtaaatgaaaacacacca
gatgtgagcttaatggaaggaaatacaccccttattccgttattaaacatatcaaaacaa
ttagggattcagttatacgggaagtatgaaggagcgaatccgacaggttcttttaaagat
cgaggcatggtaatggctgttgcgaaggcgaaagaagaaggttcggaggcaatcatttgt
gcatcgacaggtaatacatcagcatcggctgccgcatacgcggcacgccttggaatgaaa
tgtattatcgtaataccggaaggaaagattgcacatggaaaattagcacaagcagttgcg
tatggagctgaaattatttcaatagaaggaaattttgatgatgcattaaaggctgtaaga
aatatcgctgcggaagagccgattacgttagtaaactcagtgaatccttatcgaattgaa
gggcaaaaaacagcagcgtttgaaatttgtgatcagttgcaacgtgcaccagatgttcta
gcgatccctgttgggaatgccggaaatattacagcgtactggaaaggtttctgtgaatat
gagaaagaaaaaggttataaaaagccaagaattcatgggtttgaagcggaaggagcagct
gcaattgtaaaagggcatgtaattgacgagccagaaacaatcgcaactgcgattcgcatc
ggtaacccagcaagttggtcatatgcggtagaggctgctgagcaatctcacggcgaaata
gatatggtatcagatgaagagattttacatgcgtatagattattagcaaaatcggaaggg
gttttcgctgagccaggatcaaatgcttcattagccggtgtaatgaaacatgttcaatct
ggaaaaatcaaaaagggagaaacagttgttgcagttttaactggaaatggcttgaaagat
cctgatatcgcaatttcttctaatacattagatattgcaagtgtttcaaataatatagaa
caaattaaagagcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system