KEGG   Bacillus cereus AH820: BCAH820_2173Help
Entry
BCAH820_2173      CDS       T00814                                 

Definition
(GenBank) siroheme synthase, precorrin 2 oxidase and ferrochelatase domains
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
bcu  Bacillus cereus AH820
Pathway
bcu00860  Porphyrin and chlorophyll metabolism
bcu01100  Metabolic pathways
bcu01110  Biosynthesis of secondary metabolites
bcu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCAH820_2173
Enzymes [BR:bcu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     BCAH820_2173
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     BCAH820_2173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 2-Hacid_dh_C TrkA_N Pyr_redox Sirohm_synth_M XdhC_C Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ACK90645
UniProt: B7JLK0
Position
complement(2058767..2059240)
Genome map
AA seq 157 aa AA seqDB search
MYNMYPLMFNLHNKVVVIIGGGKIAYRKASGLKDTGAFVTVVSPEICKEMKELPYITWKQ
KTFSNDDIKDAHLIYAATNQHAINMMVKQAAHDFQWVNVVSDGTESSFHTPGVIRNGEYV
VTISTSGKDPSFTKRMKQELTSIFPTLIKKLSRTHKL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtataacatgtaccctcttatgtttaatctacataataaagtggtcgttatcattggt
ggaggtaaaatcgcatatcgaaaagcgtctggattaaaagatacaggcgcttttgtcacc
gttgtcagcccagaaatttgcaaggaaatgaaggaacttccttatattacttggaagcaa
aaaacttttagtaatgatgatattaaagatgctcatcttatttatgcagctacaaatcaa
catgctataaatatgatggtcaaacaggccgcccatgattttcaatgggttaacgttgta
agtgacggtacagaatcatcgtttcacacaccgggtgtcatccgaaatggtgaatatgtt
gtaacgatttcaacttcaggtaaagatccatcttttacgaagcgtatgaagcaggaacta
acatctatttttcctactcttataaaaaagctttctcgtactcacaaattataa

DBGET integrated database retrieval system