KEGG   Bacillus cereus AH820: BCAH820_4058
Entry
BCAH820_4058      CDS       T00814                                 

Gene name
mtnX
Definition
(GenBank) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase
  KO
K08966  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase [EC:3.1.3.87]
Organism
bcu  Bacillus cereus AH820
Pathway
bcu00270  Cysteine and methionine metabolism
bcu01100  Metabolic pathways
Module
bcu_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bcu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BCAH820_4058 (mtnX)
Enzymes [BR:bcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.87  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase
     BCAH820_4058 (mtnX)
SSDB
Motif
Pfam: HAD Put_Phosphatase UMPH-1 Hydrolase HAD_2
Other DBs
NCBI-ProteinID: ACK91806
UniProt: B7JL17
Position
3885570..3886229
AA seq 219 aa
MSIQVFCDFDGTITNNDNIMSIMEKFAPPEAEEVKNRILSQELSIQEGVSQLFQLIPTNL
HDEIIQFLIETAEIRNGFHEFIQFVNENNISFYVISGGMDFFVYPLLQGLIPKEQIYCNE
TDFSNEYITVNWPHPCDRLCQNHCGLCKSSLIRKLSDTNDFHIVIGDSITDLQAAKQADK
VFARDFLITKCEENHISYTPFETFHDVKTELKHLLEVKL
NT seq 660 nt   +upstreamnt  +downstreamnt
atgagtattcaagtattttgtgatttcgatggcacgattacaaataatgataacattatg
tccattatggagaaattcgcaccaccagaagctgaagaagtaaagaatagaattttatca
caagagctatctattcaagaaggtgtttctcaattatttcaattaatacctactaatctg
cacgatgaaattattcaatttttaatagagactgctgaaattcgtaatggttttcatgaa
tttatacaatttgtaaatgaaaacaatatttccttttatgttatatcaggtggaatggat
ttcttcgtctatccactcttacaaggactcattccaaaagagcaaatttactgtaatgaa
acagatttttcaaatgaatacattacggtgaattggcctcatccttgtgatcgtctttgt
caaaatcattgcggattatgtaaatcatcactcatccgtaaattgagtgatacgaatgac
ttccatattgtaattggagattcaattaccgatttacaagctgcaaaacaagcggataaa
gtgttcgctcgtgatttccttattacaaaatgcgaagaaaatcatatttcttatacacca
tttgaaacgtttcacgatgttaaaactgaattaaaacatttgttggaggtgaaattatga

DBGET integrated database retrieval system