KEGG   Bacillus cereus AH820: BCAH820_4838Help
Entry
BCAH820_4838      CDS       T00814                                 

Gene name
moaE3
Definition
(GenBank) molybdopterin converting factor, subunit 2
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
bcu  Bacillus cereus AH820
Pathway
bcu00790  Folate biosynthesis
bcu01100  Metabolic pathways
bcu04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:bcu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCAH820_4838 (moaE3)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BCAH820_4838 (moaE3)
Enzymes [BR:bcu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     BCAH820_4838 (moaE3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoaE PGAP1
Motif
Other DBs
NCBI-ProteinID: ACK87656
UniProt: B7JSY4
Position
complement(4576166..4576630)
Genome map
AA seq 154 aa AA seqDB search
MTNTYYEVIDTEISIEEVAKRVIRRECGAVTTFIGTVREFTKGRRTLYLEYVAYKTMAEK
MLEKIGSEVKGKWPGTHVAITHRIGTLQISDIAVVVAVSTPHRKAAYEANEYIMERIKQI
VPIWKKEFWEDGDSWIGDQLEKTPYPAGEPGKEL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatacgtattatgaagtaattgatacagaaatctccattgaagaggtagcgaag
agagtaattcgccgcgaatgcggtgctgttacaacatttattggaacggttagagagttt
acgaaagggcgccgtacattatacttagaatatgtcgcttataaaacgatggcagaaaag
atgctagagaaaatcggatcagaagtgaagggaaaatggccaggtacacacgttgcgatt
acacatcgcatcggtacactgcaaatttctgatatcgcggttgttgtagctgtttcaacg
ccgcatcgtaaagcggcctatgaagcaaatgaatatattatggaacgcataaaacaaatt
gttccgatttggaaaaaggagttttgggaagatggagactcttggattggcgatcaatta
gaaaaaacgccatatccggcgggagagcctgggaaggagctataa

DBGET integrated database retrieval system