KEGG   Bacillus cereus AH820: BCAH820_4887Help
Entry
BCAH820_4887      CDS       T00814                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
bcu  Bacillus cereus AH820
Pathway
bcu00010  Glycolysis / Gluconeogenesis
bcu00020  Citrate cycle (TCA cycle)
bcu00620  Pyruvate metabolism
bcu01100  Metabolic pathways
bcu01110  Biosynthesis of secondary metabolites
bcu01120  Microbial metabolism in diverse environments
bcu01130  Biosynthesis of antibiotics
bcu01200  Carbon metabolism
Module
bcu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAH820_4887 (pckA)
   00020 Citrate cycle (TCA cycle)
    BCAH820_4887 (pckA)
   00620 Pyruvate metabolism
    BCAH820_4887 (pckA)
Enzymes [BR:bcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     BCAH820_4887 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_16 AAA_33
Motif
Other DBs
NCBI-ProteinID: ACK88492
UniProt: B7JT33
Position
4618638..4620224
Genome map
AA seq 528 aa AA seqDB search
MSTVNVQIGLHELLNGSNAQIQLSVPQLVEKVLMRNEGKLTSTGAVSASTGKYTGRSPKD
KFIVKEASVADKIAWGAVNQPISEEHFNKLYTKVLEYLKEKEELFVFKGFAGADRNYRLP
IQVINEYAWHNLFVHQLFIRPTEEELTTHESEFTIVSAPNFKADPAVDGTNSEAFIMVSF
EKRIVLIGGTEYAGEMKKSIFSIMNFLLPEQDILSMHCSANVGEEGDVALFFGLSGTGKT
TLSADPNRKLIGDDEHGWSDNGVFNIEGGCYAKCVNLSHEKEPQIFDAITFGSVLENVII
NDQTRIADYNDTTLTENTRAAYPMHAIDNIVLPSVAGHPNTIIFLTADASGVLPPISKLS
KEQAMYHFLSGYTSKLAGTERGVTSPQATFSTCFGSPFLPLDASRYAEMLGEKIEKHDAK
VFLVNTGWTGGEYGVGKRMNLGYTRAMIQAALNGELAKTETAKHDIFGLEVPLHVPGVPD
EVLMPEQTWADKAAYKAKAIELANEFKANFKKFDSVSEDIINLGGPIA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgtgaatgtccaaattggtttacacgaattattgaacggaagcaatgcacag
attcaactaagtgttccgcaattagtggaaaaagtattaatgcgaaatgaagggaaatta
acttcgactggtgccgtttctgcttcaactggaaaatatacaggacgttctcctaaagat
aaatttattgtgaaagaagcatcggttgctgacaaaattgcttggggagctgtgaatcaa
ccgatttctgaagaacattttaataaattatatactaaagttttagaatacttaaaagaa
aaagaagagttattcgtcttcaaaggatttgcaggcgcggaccgcaattaccgtctacca
atccaagttattaatgaatatgcatggcacaatttatttgtacatcaattattcattcgt
ccaactgaagaagaattaacgactcatgaatcagaattcacaattgtttctgcaccaaat
ttcaaagctgatccagctgttgacggtacaaactctgaagcattcattatggtttcattc
gaaaaacgtatcgtactaattggtggtacagaatacgctggagaaatgaaaaaatcaatc
ttctctattatgaacttcttactacctgaacaagatattctttctatgcattgctctgca
aacgtaggtgaagaaggcgacgtagcactattcttcggtttatctggaacaggtaaaaca
acattatctgctgatccaaaccgtaaattaatcggtgatgatgagcatggttggtctgat
aacggtgtattcaatattgaaggcggttgctacgcaaaatgtgtaaacctttctcacgag
aaagaaccacaaattttcgatgcaatcacatttggatctgttttagaaaacgttatcatt
aatgaccaaacgcgtatcgcagactataacgatactactttaacagaaaatactcgtgct
gcataccctatgcatgcgatcgacaatatcgtattgccaagtgttgctggacacccaaat
acaattattttcttaactgctgatgcatctggcgtattgcctccaatcagcaagttatca
aaagaacaagctatgtaccatttcttaagtggttacactagtaaactagcaggaacagag
cgcggcgttacatcaccgcaagcaacattctcaacttgcttcggttcaccattcttacca
cttgatgcatctcgctatgctgaaatgcttggtgaaaaaatcgagaaacacgatgcaaaa
gtattcttagtaaacactggctggactggtggcgaatacggcgttggtaaacgcatgaac
ttaggttacactcgtgcaatgattcaagcagcattaaacggtgaacttgcgaaaactgaa
acagctaaacatgacatcttcggtcttgaagttccacttcacgtaccaggtgtacctgac
gaagtgttaatgcctgaacaaacttgggctgataaagctgcttacaaagcaaaagcaatc
gaacttgcaaatgaattcaaagcgaacttcaaaaagttcgacagcgtttctgaagatatt
attaacttaggcggtccaatcgcttaa

DBGET integrated database retrieval system